KEGG   Roseovarius sp. AK1035: RAK1035_0378Help
Entry
RAK1035_0378      CDS       T05517                                 

Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00061  Fatty acid biosynthesis
rok00071  Fatty acid degradation
rok01100  Metabolic pathways
rok01212  Fatty acid metabolism
rok02024  Quorum sensing
Module
rok_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RAK1035_0378
   00071 Fatty acid degradation
    RAK1035_0378
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RAK1035_0378
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rok01004]
    RAK1035_0378
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rok04147]
    RAK1035_0378
Enzymes [BR:rok01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     RAK1035_0378
Lipid biosynthesis proteins [BR:rok01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   RAK1035_0378
Exosome [BR:rok04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   RAK1035_0378
  Exosomal proteins of breast cancer cells
   RAK1035_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AWZ19089
Position
complement(366275..368221)
Genome map
AA seq 648 aa AA seqDB search
MDSVPALLQRNATRFADRPAYREKEYGIWQCWTWAEAEKEIEALALGLINLGVNEGDFVA
VIGRNRPHFYWSMVAAQSVGAIPVPLYQDAAAPEMAYVMEHCGARFAIVQDQEQVDKLIE
VQEGLHQLEHMIYVDPRGLRKYDHHKLHRFIDIQEQGRAAYYEWIEDLKTRRAKLTYDSV
CVMLYTSGTTGKPKGVVLSNRNIIEASKSSSEFDHLTKDEEVLAYLPMAWVGDFIFSIGQ
AYWCGFCVNCPESPETMQTDLREIGPTYFFAPPRVFETQLTNVMIRMEDAGRVKKWLFDH
FMSHARRVGPAILDGKPVSGLDRLKYRLGNLFIYGPLKDTLGLGRVRVGYTAGEAIGPEI
FDFYRSLGINLKQLYGQTEASVFITLQPDGEVRSDTVGVPAPGVEIRISDTGEVFYRSAG
TFEYYYKNPESTASTKDPEGWVATGDAGFFEEGSGHLRIIDRAKDVGKMADGRMFAPKYV
ENKLKFYPNILEAVVFGNGRNACTAFINIDLTAVGNWAERNNIGYASYQELAGHPKVLET
IKGHVEEVNRSLADDPMLSHCQVHRFLVLHKELDADDGEMTRTRKVRRGVISEKFDDLLT
ALYDGSPEIYTTTEVTYEDGRKGAISATLKIVDAKVASVATMQRVAAE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggattccgttccggcgctcttgcaacgtaacgccacgcgatttgccgatagaccggcc
tatcgcgaaaaggaatatgggatctggcagtgctggacatgggccgaggccgagaaggag
atcgaggcgcttgcgctcgggctcatcaatcttggtgtgaatgagggcgatttcgtcgcc
gtcatcggccgcaaccgtccgcatttctactggtccatggtcgccgcgcaatctgtcggt
gcaatccccgttccgctctaccaagatgctgccgcccccgagatggcctatgtgatggag
cattgtggggcacgctttgccatcgttcaggatcaagaacaggtcgacaagctgatcgag
gtgcaggaggggctgcaccaactggagcatatgatctatgtcgatccgcgcggcttgcgc
aaatatgatcaccacaagttgcaccgcttcatcgacattcaggagcagggccgcgccgcc
tattacgaatggatcgaagatctcaagacgcgacgcgcgaaactgacctatgacagcgtt
tgcgtcatgctttacacctcgggcaccacgggcaagcccaagggcgtggtgctgagcaat
cgcaacatcatcgaggcgtccaaatcgtcttccgagtttgaccatctgaccaaggacgaa
gaggtgctggcctatctgccgatggcttgggtgggcgatttcattttctccatcgggcag
gcctattggtgcgggttttgtgtcaactgtcctgagagcccagagaccatgcagaccgac
ctgcgtgaaattgggcccacctatttctttgcgccgccccgcgtgttcgagacgcagttg
accaatgtgatgatccggatggaggatgcgggccgcgtcaagaaatggctctttgaccat
ttcatgtcccatgcccgccgcgtcggccctgcgatcctcgatggtaagccggtcagcggt
ctggaccgcctcaaataccggcttgggaacctctttatctatggcccactcaaggacacg
cttggccttggccgcgtgcgcgtgggctatactgcaggtgaggcgattgggccggagatt
ttcgatttctatcgctcgcttggcatcaacctcaaacaactctacgggcaaaccgaggct
tcggtgtttatcaccctgcaacccgatggcgaagtgcgctctgacacggttggcgtcccc
gcgcccggcgtggaaatccgtatcagcgacaccggcgaggtgttctatcgttcagcgggc
acgtttgaatattactacaagaatcctgaaagcacggcctcaaccaaagaccccgaaggt
tgggtcgccaccggtgatgcgggctttttcgaggaaggcagtgggcatcttcgcatcatc
gaccgcgccaaggatgtgggcaagatggctgatggccggatgttcgctcccaaatatgtg
gaaaacaagctcaagttctatcccaatattctcgaggcggtcgtctttggcaacgggcgt
aacgcctgcaccgcctttatcaacatcgacctgacagcggtgggtaactgggcggagcgg
aacaatatcggctatgcctcgtatcaggaacttgccgggcatccgaaggtgcttgaaacg
atcaagggccacgtcgaagaggtcaatcgcagcctcgcggatgatccgatgctgtcgcat
tgccaggtgcatcgcttcctcgtgctgcacaaagaactggatgccgacgatggcgagatg
acgcgcactcgcaaggtgcggcgtggtgtgatctctgagaaattcgatgacctgctgacc
gcgctctatgacgggtcgcctgaaatctacaccaccactgaagtgacctatgaggatggc
cgcaagggggcgatcagcgcgacgctcaagatcgtcgatgccaaggtggcctcggtggcg
acgatgcaaagggtggcggcagaatga

DBGET integrated database retrieval system