KEGG   Roseovarius sp. AK1035: RAK1035_0670Help
Entry
RAK1035_0670      CDS       T05517                                 

Definition
(GenBank) Succinyl-CoA ligase, ADP-forming alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00020  Citrate cycle (TCA cycle)
rok00640  Propanoate metabolism
rok00660  C5-Branched dibasic acid metabolism
rok01100  Metabolic pathways
rok01110  Biosynthesis of secondary metabolites
rok01120  Microbial metabolism in diverse environments
rok01130  Biosynthesis of antibiotics
rok01200  Carbon metabolism
Module
rok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rok_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RAK1035_0670
   00640 Propanoate metabolism
    RAK1035_0670
   00660 C5-Branched dibasic acid metabolism
    RAK1035_0670
Enzymes [BR:rok01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RAK1035_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AWZ19381
Position
complement(677038..677919)
Genome map
AA seq 293 aa AA seqDB search
MAVLVDKHTRVICQGLTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLDLPVFNSVHEA
KHVTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMRVKRALEGSKSRLI
GPNCPGIITPDACKIGIMPGHIHRRGSVGVVSRSGTLTYEAVKQTSDVGLGQSTCVGIGG
DPIKGTEHIDVLEWFLADDETQSIIMIGEIGGSAEEEAAQFLKDEAKRGRKKPVAGFIAG
RTAPPGRRMGHAGAIVAGGKGDAESKIEAMKSAGITVAESPAGLGEAVLKAIG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcctcgtcgacaaacatacccgcgtgatctgtcagggccttaccggctcgcag
ggcacattccactctgaacaggccatcgcctatggcacccagatggtcggcggcgtgacc
cccggcaagggtggcacgacgcatctcgacctgcccgtattcaactcagtacatgaggcc
aagcatgtgacagaggccaatgcgagcgtcatctacgtgccgccgccctttgctgcggat
tccattctcgaggcgattgatgccgagatggagctgattgtctgcatcaccgaaggcatc
ccggttttggacatgatgcgcgtcaagcgcgcgctcgaagggtcgaaatcgcgcctcatc
ggcccgaactgccccggcatcatcacgcccgacgcctgcaagatcggcatcatgcccggc
catatccaccggcgcggcagcgtcggcgtggtcagccgctcgggcacgctgacctatgag
gcggtcaagcagacctcggatgtgggccttggccagtcgacttgcgtcggcatcggcggc
gacccgatcaagggcaccgaacatatcgacgtgctggaatggttcctggccgatgacgaa
acgcagtcgatcatcatgatcggcgaaatcggcggtagcgcggaagaagaggcggcgcag
ttcctgaaagacgaagccaaacgcgggcgtaaaaaacctgtcgcaggctttatcgccggg
cgcacagccccgccgggccgccgcatgggccacgccggcgccatcgtcgcgggcggcaaa
ggcgacgccgagagcaagatcgaagccatgaaatccgccggcatcaccgtggccgaaagc
cccgctggcctcggcgaggccgtgctcaaggcgattgggtaa

DBGET integrated database retrieval system