KEGG   Roseovarius sp. AK1035: RAK1035_1699Help
Entry
RAK1035_1699      CDS       T05517                                 

Definition
(GenBank) S-(hydroxymethyl) glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00010  Glycolysis / Gluconeogenesis
rok00071  Fatty acid degradation
rok00350  Tyrosine metabolism
rok00625  Chloroalkane and chloroalkene degradation
rok00626  Naphthalene degradation
rok00680  Methane metabolism
rok01100  Metabolic pathways
rok01110  Biosynthesis of secondary metabolites
rok01120  Microbial metabolism in diverse environments
rok01130  Biosynthesis of antibiotics
rok01200  Carbon metabolism
rok01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAK1035_1699
  09102 Energy metabolism
   00680 Methane metabolism
    RAK1035_1699
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RAK1035_1699
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RAK1035_1699
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RAK1035_1699
   00626 Naphthalene degradation
    RAK1035_1699
Enzymes [BR:rok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RAK1035_1699
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     RAK1035_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N UDPG_MGDP_dh_N ThiF
Motif
Other DBs
NCBI-ProteinID: AWZ20410
Position
1750033..1751145
Genome map
AA seq 370 aa AA seqDB search
MRTRAAVAVEAGRPMEIMEVNLEGPKAGEVLVEIKATGLCHTDDFTLSGADPEGAFPAIL
GHEGAGVVLEVGPGVTSLQPGDHVIPLYTPECRECEYCLNPKTNLCQKIRSTQGQGVMPD
GTSRFSMLDGTPILHYMGCSTFANHTVLPEIALAKVRKDAPFDKICYIGCGVTTGVGAVI
NTAKVEIGSRAIVFGLGGIGLNVLQGLRLAGADQIVGVDINPGRIEMATRFGMTDFVNPK
EVSGDLVAHLVALTGGGADYTFDATGNVGVMRTALEAAHKGWGESIIIGVAPAGAEISTR
PFQLVTGRSWRGTAFGGARGRTDVPKIVDWYMQGKIEIDPMITHTMPLEDINKGFELMHA
GESIRSVVIY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacacgtgctgcggttgcggttgaggcaggccgcccgatggagatcatggaggtg
aaccttgagggtccgaaggcgggcgaggttctggtggagatcaaggcgacgggcctgtgc
cacaccgatgatttcaccctgtcgggggccgatcccgagggggcgtttccggccattctg
gggcatgagggcgcgggcgttgtgctcgaggtgggccccggtgtcaccagcctgcaaccg
ggcgatcacgtcattccgctttacacgcccgaatgccgtgaatgcgaatactgcctcaac
ccgaaaaccaacctgtgccagaaaatccgctcgacccaaggccagggcgtgatgcccgat
ggcaccagccggttttcgatgctggatggcacgccgatcctgcattacatgggctgctcg
acctttgccaatcacacggtcctgcccgagattgcgctcgcgaaggtgcgcaaggatgcg
ccctttgacaagatttgctacatcggctgcggtgtcaccacgggcgtgggggcggtgatc
aacaccgccaaggtcgagatcggcagccgggcgattgtgttcggtctgggcggcatcggc
ctcaacgtgctgcaggggctgcggctggcgggggcggatcagatcgtcggcgtcgatatc
aatccgggccggatcgagatggcgacgcgctttggcatgaccgatttcgtcaaccccaag
gaggtttcgggcgatcttgtggcgcatcttgtggcgctgaccggcgggggggcggattac
acattcgatgccaccggcaatgtgggcgtgatgcgcacggcgctcgaggcggcgcataag
ggctggggcgagagcatcatcatcggtgtggcacctgcgggcgcggaaatcagcacgcgg
ccgttccaactggtcacggggcgcagctggcgcggcacagcctttggcggcgcgcgcggg
cgcacggatgtgcccaagattgtcgattggtacatgcagggcaagatcgagatcgacccg
atgatcacccacaccatgccgctcgaggatatcaacaaagggtttgagctcatgcacgcc
ggcgaaagcatccgcagcgtggtgatttactaa

DBGET integrated database retrieval system