KEGG   Roseovarius sp. AK1035: RAK1035_1927Help
Entry
RAK1035_1927      CDS       T05517                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
rok  Roseovarius sp. AK1035
Pathway
rok03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rok00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RAK1035_1927
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rok03011]
    RAK1035_1927
Ribosome [BR:rok03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RAK1035_1927
  Bacteria
    RAK1035_1927
  Archaea
    RAK1035_1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 KORA
Motif
Other DBs
NCBI-ProteinID: AWZ20636
Position
2003118..2003498
Genome map
AA seq 126 aa AA seqDB search
MGKEKNPRRVADNEAMAKLRMLRTSPQKLNLVAAMIRGKKVDKALTDLTFSNKRIAQDVK
KCLQSAIANAENNHNLDVDGLIVAEAYVGKNLVMKRGRPRARGRFGALKKPFSELTIKVR
EIEEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggaaaagaacccccgccgcgtggcagacaacgaagcaatggccaagttgcgc
atgcttcgtaccagcccgcagaagctgaacctcgttgccgcgatgatccgtggcaagaag
gtcgacaaggcgctgaccgatctcactttctcgaacaagcgcatcgcgcaggacgtcaag
aagtgtcttcagtccgcaattgccaatgctgagaacaaccacaatctcgatgtggatggt
ctgatcgtggcagaggcctatgtcggcaagaaccttgtgatgaagcggggccgtccgcgt
gcccgtggtcgctttggcgcgctgaaaaagccgttttcggagctgacgatcaaggttcgt
gaaattgaggagcaagcctaa

DBGET integrated database retrieval system