KEGG   Roseovarius sp. AK1035: RAK1035_3777Help
Entry
RAK1035_3777      CDS       T05517                                 

Definition
(GenBank) Geranylgeranyl pyrophosphate synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
rok  Roseovarius sp. AK1035
Pathway
rok00900  Terpenoid backbone biosynthesis
rok01100  Metabolic pathways
rok01110  Biosynthesis of secondary metabolites
rok01130  Biosynthesis of antibiotics
Module
rok_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:rok00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RAK1035_3777
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rok01006]
    RAK1035_3777
Enzymes [BR:rok01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     RAK1035_3777
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     RAK1035_3777
    2.5.1.29  geranylgeranyl diphosphate synthase
     RAK1035_3777
Prenyltransferases [BR:rok01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   RAK1035_3777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AWZ22482
Position
complement(3895834..3896703)
Genome map
AA seq 289 aa AA seqDB search
MPIETRIEAAIAQAIARGQAGQTPARLADALDYSTSPGGARIRPTILMSVALACGDDRPE
LSDAAAAALEIMHCASLVHDDLPCFDDADLRRGKPSVHRAYSEPLAVLAGDALIIMSFEI
LARVAECDAARANALILALARRSGMPNGICAGQGWESEPTVDLEAYHRSKTGALFIAATQ
MGAIAAGHEPEPWYELGARIGAAFQVADDLRDALLDAETLGKPVGQDDLHGRPNAVSELG
VAGAVTRLKDILAGAISSIPSCPGEARLAKMVQMQAERIISVLPARMRA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcccattgagacccgcattgaagcggccatagcgcaggcgattgcgcgggggcaggcg
gggcagaccccggcccgattggcggatgccctcgattattccaccagccccggcggcgcg
cgcatacgtccgacgattctcatgtctgtggcgctggcctgcggcgatgatcgccctgaa
ttgagcgatgccgccgctgccgcgctggaaatcatgcattgtgcaagccttgtgcatgac
gatttgccgtgtttcgatgatgccgatttgcggcgcggcaagccttcggtgcatcgcgcc
tattccgaaccgctggcggtgctggcgggtgatgcgcttatcatcatgtcgtttgaaatt
cttgcccgagtggcagagtgcgatgcggcgcgcgccaatgcgctgattctggcgctggcg
cggcgcagtggcatgccaaacggcatttgtgccgggcagggctgggagagtgagccgacc
gttgatctggaggcctatcaccgttccaagaccggcgcgctctttattgccgccacgcag
atgggggccatcgcggcggggcacgagcccgagccgtggtatgagctgggcgcgcgcatt
ggcgccgcgtttcaggtggcggatgatctgcgcgatgcgcttttggatgccgaaaccttg
ggcaagccggtggggcaggatgatctgcacgggcggcccaatgccgtatcggaattgggt
gtggccggggctgtgacgcggctcaaggatattctggcaggggcgatttcgtcgattccg
tcctgtcccggcgaggcgcggctggccaagatggtgcagatgcaggccgaacgcattatc
tcggtgctgcctgcgcgcatgcgggcctga

DBGET integrated database retrieval system