KEGG   Raoultella ornithinolytica S12: TE10_00870Help
Entry
TE10_00870        CDS       T03629                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00520  Amino sugar and nucleotide sugar metabolism
ron01100  Metabolic pathways
ron01503  Cationic antimicrobial peptide (CAMP) resistance
Module
ron_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TE10_00870
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    TE10_00870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ron01005]
    TE10_00870
Enzymes [BR:ron01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     TE10_00870
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     TE10_00870
Lipopolysaccharide biosynthesis proteins [BR:ron01005]
 Unusual sugar
  TE10_00870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 Sacchrp_dh_NADP TrkA_N NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AJF70696
Position
complement(164881..166866)
Genome map
AA seq 661 aa AA seqDB search
MKAVVFAYHDMGCAGIQSLLDAGYDIAAIFTHPDNPGENHFFGSVARLAAEQGIPVWAPE
DVNHPLWIERIREMKPDVLFSFYYRNLLGDEILNLAPQGAFNLHGSLLPKYRGRAPLNWV
LVNGESETGVTLHRMIGRADAGDIVAQQSVAIGADDVALTLHRRLCTAASELLGQALPAI
REGNVAARAQDESQATYVGRRTPEDGRLDWEQPAQVLHNLVRAVSDPWPGAFGYTGANKF
IVWKSRVRRDLPAAKPGTVLSTAPLVVACQDGALEIVTGQTDRGVYIQGTQLAQALGLVS
GAVLSSKPVVAIKRRTRVLILGVNGFIGNHLTERLLQDDNYEIYGLDIGSDAISRFLENP
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYDKRIIFPSTSEVYGMCTDKNFDEDSSNLVVGPINKQRWIYSVSKQLLDRVIWAYGDK
AALRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIEGGKQKRCFTDI
SDGIEALFRIIENKDGRCDGQIINIGNPDNEASIKELAEMLLDCFERHPLRGNFPPFAGF
RDVESSDYYGKGYQDVEHRKPSIRNAKRCLSWTPTVPMEETVEHTLDFFLRTVELADDKT
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagtcttcgcttatcacgatatgggttgtgcaggtattcagtccctgctg
gacgccgggtatgacatcgccgctattttcacccatccggataaccccggcgaaaaccat
ttctttggttcggtggcgcgtctcgctgcggaacagggtatcccggtatgggcgccagaa
gatgtgaatcacccgctgtggattgaacgtatccgcgaaatgaagccggacgtgctgttc
tccttctactaccgcaatctgctgggcgatgagatcctcaatcttgcgccgcagggcgcc
tttaacctgcacggctccctgctgccgaaatatcgcggccgcgcgccgctgaactgggtg
ctggtcaacggagagagcgaaacgggcgttaccctgcatcgcatgatcggccgcgccgat
gccggcgatattgtcgcccagcagtcggtggccattggggccgatgacgtggcgctgacc
ctgcaccgcaggctgtgcacggcggcgtccgagctgctgggccaggcgctgccggcgatc
cgcgaaggcaacgttgccgcgcgcgcgcaggatgagagccaggcgacctacgttggccgc
cgcacgccggaagatggccgccttgactgggagcagcccgcgcaggtcctgcataacctg
gtccgcgccgtctccgatccgtggccgggcgcatttggctacaccggcgccaacaaattt
atcgtctggaaatctcgcgtccgtcgcgatctgccggcagcgaagccggggacggtgctc
tccaccgcgccgctggtggtcgcctgccaggacggagcgctggaaatcgttaccggtcag
accgatcgcggcgtctatattcagggcacgcagctggcgcaggccctgggcctggtctcc
ggcgcggtgctgagcagcaaaccggtcgtggcaattaagcgccgcacccgcgtgctgatc
ctcggcgttaacgggtttatcggcaaccatctgaccgagcgcctgctgcaggacgataat
tacgaaatctacgggctggatatcggttctgatgccatcagccgcttcctcgagaatccg
cgcttccacttcgtcgaaggggatatcagcattcactcggaatggattgagtatcacatt
aagaaatgcgacgtggtgctgccgctggtggcgatcgctacgcctatcgaatacacccgt
aacccgctgcgcgtgttcgagctggacttcgaagagaacctgaagattatccgcgactgc
gtgaagtacgataagcgcattatcttcccgtcgacctctgaagtgtacggcatgtgtacc
gataaaaacttcgatgaagacagctcgaacctggtggtggggccaatcaacaagcagcgc
tggatctattccgtgtcgaagcagctgctcgaccgcgttatctgggcctacggcgacaaa
gccgcgctgcgcttcaccctgttccgtccgtttaactggatgggaccgcgtctggataac
ctcaacgccgcgcgtattggcagctcccgcgccattacccagctgatcctcaacctggtt
gaaggctcgccgattaagcttatcgaaggcggcaagcagaagcgctgcttcaccgatatc
agcgacggtattgaagcgctgttccgcattatcgagaacaaagacggccgctgtgacggg
cagattatcaacatcggtaacccggacaacgaagccagtattaaagagctggccgagatg
ctgctggattgcttcgagcgccatccgctgcgcggcaacttcccgccgttcgccggtttc
cgcgatgttgaaagcagcgactactacggtaaaggttatcaggacgtcgagcaccgtaag
ccgagcatccgcaacgcgaagcgctgcctgagctggacgccgacggtaccgatggaagag
accgtcgagcataccctcgacttcttcctgcgcaccgttgagctggcggatgataagaca
tcatga

DBGET integrated database retrieval system