KEGG   Raoultella ornithinolytica S12: TE10_02530Help
Entry
TE10_02530        CDS       T03629                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00010  Glycolysis / Gluconeogenesis
ron01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TE10_02530
Enzymes [BR:ron01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     TE10_02530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P PerC
Motif
Other DBs
NCBI-ProteinID: AJF71007
UniProt: A0A4R2XR47
Position
544013..544603
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGTWSDLSRIPLATLKQHFTMGEAFRQHERGEISDEAFAEA
MCHEMNMALSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPDE
YPQVRAAADRIYLSQEMGMRKPEERIYQSVLQQEGFSAADTVFFDDNAENIAGANRLGIT
SILVTGKETIPDYFAQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgacatcgacttcaaccgggtactc
gggacgtggagtgatttaagccgcattccgctggcgacgctgaagcagcacttcaccatg
ggtgaggcgtttcgccagcacgagcgcggtgaaatcagcgatgaagccttcgctgaagcg
atgtgccatgagatgaatatggcgctgagctatgagcagttttcccacggctggcaggcc
gtgtttgtggcgctgcgtccggaggtcatcgcgattatgcacaagctacgcgagcaggga
caccgcgtcgtcgtgctgtcgaataccaaccgcctgcacaccactttctggccagatgaa
tatccgcaggtgcgcgccgcggccgaccgtatctatctttcgcaggagatggggatgcgt
aagcccgaggagcggatctaccaaagcgttctgcagcaggagggattttccgctgccgat
acggtcttctttgacgataatgccgagaatatcgccggtgcgaaccggctgggaataacc
agtattttggtgaccggaaaggagactatccccgactactttgcgcaatga

DBGET integrated database retrieval system