KEGG   Raoultella ornithinolytica S12: TE10_06015Help
Entry
TE10_06015        CDS       T03629                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
ron  Raoultella ornithinolytica S12
Brite
KEGG Orthology (KO) [BR:ron00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    TE10_06015 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Pax2_C
Motif
Other DBs
NCBI-ProteinID: AJF71644
UniProt: A0A4R2XRN7
Position
complement(1289023..1289400)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSVYIESQSSPENDRYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRET
EVQGEGVVGEQPHIPAGGEFQYTSGAVIETPLGTMQGHYAMIDVNGAPFSVDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtttgtgtacaggtacaaagcgtctatatcgaatcgcagtct
tctccggaaaacgatcgttacgtcttcgcttataccgtcaccatccgcaacctggggcgg
agtcaggttcagctacttggccgctactggcttatcaccaacggtcacggtcgtgagact
gaggttcagggtgaaggggttgtcggcgagcagccgcatattcccgctggcggggagttt
caatacaccagcggcgcggttattgaaacgccgctgggcaccatgcagggacattacgct
atgatcgacgtgaacggtgcgccgttctccgtcgacatccctgttttccgtctcgcagta
ccaacgctcattcactaa

DBGET integrated database retrieval system