KEGG   Raoultella ornithinolytica S12: TE10_06590Help
Entry
TE10_06590        CDS       T03629                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00860  Porphyrin and chlorophyll metabolism
ron01100  Metabolic pathways
ron01110  Biosynthesis of secondary metabolites
ron01120  Microbial metabolism in diverse environments
Module
ron_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
ron_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TE10_06590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ron01007]
    TE10_06590
Enzymes [BR:ron01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     TE10_06590
Amino acid related enzymes [BR:ron01007]
 Aminotransferase (transaminase)
  Class III
   TE10_06590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJF71754
Position
complement(1427961..1429241)
Genome map
AA seq 426 aa AA seqDB search
MSKSETLFSAARELIPGGVNSPVRAFNGVGGTPLFIERADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAQRGLSFGAPTEMEVKMAALVTELVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLASVRAAFEQYPQEVACIIVEPVAGNMNCIPPQPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQSYYDVVPDLTCLGKIIGGGMPVGAFGGRREVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLTEVAQPGVHETLTDLTNQLAQGLLDAARDAGIPLVVNNVGGMFGLFFT
DAESVTCYQDVVKCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSVAHSEDDINNTIAAAR
RAFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatctgaaactctctttagcgccgcacgtgagcttatccccggcggcgttaac
tcgccggtacgagcctttaacggcgttggcggcacgccgctgtttatcgaacgtgcggac
ggcgcgtatctgtacgacgtcgacggtaaagcctatatcgattatgtcggttcctggggc
ccgatggtactcggtcacaaccacccggccattcgtaatgcggtcattgaagcggcgcag
cgcggcctgagcttcggcgcaccgacggaaatggaagtaaaaatggcggcgctggtgacg
gagctggtgccgacgatggatatggtgcggatggttaactccggcaccgaggccaccatg
agcgccattcgcctggcgcgcgggtttaccggccgcgataaaatcatcaaatttgaaggc
tgctaccacggtcacgccgactgcctgctggtcaaagcgggctccggcgccctgaccctc
ggccagccgaactccccgggcgtgccggccgatttcgccaaacacaccctgacctgcacc
tataacgacctggcgtcggtccgcgccgcattcgagcagtatccgcaggaggttgcctgc
attatcgttgagccggtggcgggcaatatgaactgcatcccgccgcagccggagttcctg
cctggcctgcgcgcgctgtgcgacgaatttggcgccctgctgattattgacgaagtgatg
accggcttccgcgttgctctggcgggcgcccagtcgtactacgatgtggtccctgatctg
acctgcctgggcaaaatcatcggcggcggcatgccggtgggcgccttcggcggccgtcgt
gaagtgatggatgcgctggcgccgaccggcccggtctatcaggcgggcaccctgtccggt
aacccgatcgccatggcggcgggcttcgcctgcttaaccgaagtggcgcagccgggagtt
cacgaaacgctgacggatttaaccaaccagctggcccaggggctgctggacgccgcgcgc
gacgcgggcattccgctggtggtgaataacgttggcggcatgttcggcctcttctttacc
gacgccgaaagcgtcacctgctatcaggacgtggtgaagtgcgacgttgagcgcttcaag
cgcttcttccacctgatgctggaagagggcgtgtatctggcgccttcggcgtttgaagcc
ggatttatgtccgttgcccacagcgaagacgatatcaacaataccatcgccgccgcgcgc
cgcgcgttcgccaaactgtag

DBGET integrated database retrieval system