KEGG   Raoultella ornithinolytica S12: TE10_07020Help
Entry
TE10_07020        CDS       T03629                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00310  Lysine degradation
ron01100  Metabolic pathways
ron01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    TE10_07020
Enzymes [BR:ron01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     TE10_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Mqo NAD_binding_8 Lycopene_cycl HI0933_like Amino_oxidase Trp_halogenase FAD_binding_2 Thi4 Pyr_redox GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AJF71828
Position
complement(1515609..1516877)
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTAMQLREVYPDARVMLLEKESAPACHQTGRNSGVIHAGVYYTPGS
LKAQFCLAGNRATKAFCQRHGIRYDVCGKMLVATSPLEMARMRALWDRTAANGLQREWLS
AEALREREPNITGTGAIFVPASGIVSYREVTEAMAKTFVAGGGEIVYAAEVSALKEHAAG
VVVYTKQGQEFEAATLVSCSGLMADRVVKMLGVDPGFIVCPFRGEYFRLAPQHNQIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKRDFSLSDTLEILGSPAIRR
VLQGNLRSGLGEMKNSLCKGGYLRLVQKYCPSLALQDLQPWPAGVRAQAVSPHGRLIDDF
LFVTTARSIHTCNAPSPAATSALPIGAHIVGKVQALLARQHNPGRSLRAARSADSVLAEY
TR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgtgattattggcggcggcattatcggcatgtcgaccgccatgcagctg
cgggaggtctacccggacgccagagttatgctgctggagaaagagtccgcgccggcctgt
catcagaccggtcgcaatagcggcgtgattcatgccggagtctactacactcccgggagc
ctcaaagcgcagttctgccttgccggcaatcgggcgaccaaagccttttgccagcggcac
ggcatccgctatgacgtctgcggaaaaatgctggtcgccacctcgccgctggagatggcg
cggatgcgggcgctgtgggatcgcaccgcggccaacggcctgcagcgcgaatggcttagc
gcggaggcgctgcgcgagcgggagccgaatattaccggcaccggcgccatttttgtcccc
gccagcgggattgtcagctatcgcgaagttaccgaggcgatggcgaaaaccttcgtcgcc
ggcggcggggaaattgtctacgccgccgaggtcagtgccctgaaagagcacgccgccggc
gtggtcgtctacactaaacagggacaggagtttgaagccgccaccttagtgagctgtagc
ggcctgatggccgacagggtggtcaaaatgctcggcgtcgatcccggttttattgtctgc
ccgtttcgtggggagtatttccgcctggcgcctcagcataaccagatagtgaatcatctg
atctacccaatacccgacccggcgatgccgtttctcggggtccacctcacccgcatgatt
gacggcagcgtgaccgtgggcccgaatgcggtgctcgccctgaagcgtgaaggctatcgc
aaacgcgatttttcactctccgatacgctggaaatcctcggttcgcccgctattcgtcgc
gtgctgcagggcaacctgcgttcgggcttaggcgaaatgaaaaactccctgtgcaaaggc
ggctatttacggctggtacaaaagtactgcccgagcctcgctctgcaggatctccagccg
tggcctgcgggcgtccgcgcacaggcggtttctccgcacggcaggctgatcgacgatttt
ctgttcgtcaccaccgcgcgctccattcatacctgcaatgcgccctccccggcggccaca
tcggctctgcccatcggggcgcatatcgtcggcaaagtacaggcgctgctcgcccgccag
cacaaccccggccgcagcctgcgcgccgcccgtagcgccgactccgtgcttgccgaatac
acccgttaa

DBGET integrated database retrieval system