KEGG   Raoultella ornithinolytica S12: TE10_09490Help
Entry
TE10_09490        CDS       T03629                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00020  Citrate cycle (TCA cycle)
ron00640  Propanoate metabolism
ron00660  C5-Branched dibasic acid metabolism
ron01100  Metabolic pathways
ron01110  Biosynthesis of secondary metabolites
ron01120  Microbial metabolism in diverse environments
ron01130  Biosynthesis of antibiotics
ron01200  Carbon metabolism
Module
ron_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ron_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TE10_09490 (sucC)
   00640 Propanoate metabolism
    TE10_09490 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TE10_09490 (sucC)
Enzymes [BR:ron01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TE10_09490 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AJF72289
Position
2051204..2052370
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAEHWLGKRLVTYQTDAHGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKIAIDPLAGPMPYQGRELAFKLGLEGKQVQQFTKI
FMGLANIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactgtttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgcgaagcagaagaagccgcttcaaaaatcggtgcg
ggtccgtgggtagtgaaatgtcaggttcacgctggcggccgcggtaaagcgggcggtgtg
aaagtagttaacagcaaagaagacattcgcgcatttgctgaacattggctcggcaaacgc
ctggtgacctaccagacggatgcgcacggccagccggttaaccaaatcctggttgaagcg
gcgaccgatatcgccaaagagctctatcttggcgccgtggttgaccgtagctcccgtcgc
gttgtgttcatggcttccaccgaaggcggcgtggaaatcgaaaaagtggcggaagagacg
ccgcacctgatccacaaaattgctatcgacccgctggcgggcccgatgccttaccagggc
cgtgagctggcgttcaaactgggtctggaaggtaagcaggttcagcagttcaccaagatc
ttcatgggtctggcgaatattttcctcgagcgcgatctggcgctgatcgaaatcaacccg
ctggttatcaccaaacagggcgacctgatctgcctcgacggcaagctgggcgccgatggc
aatgccctgttccgtcagccggatctgcgcgaaatgcgcgaccagtctcaggaagatccg
cgtgaagctcaggctgcacagtgggagctgaactacgttgcgctggacggcaacatcggc
tgtatggttaacggcgcaggcctggcgatgggcaccatggacatcgttaagctgcacggc
ggcgaaccggctaacttccttgacgttggcggcggcgcaaccaaagagcgcgtaaccgaa
gcgtttaaaatcatcctttccgacagcaatgttaaagccgtactggttaacatcttcggc
ggtatcgtgcgttgcgacctgatcgctgacggcattatcggcgcggtagaggaagtgggc
gttaacgttcctgtggtcgttcgtctggaaggtaacaacgccgaactgggcgcgaagaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggacgcagcgcagcag
gttgttgctgcagtggaggggaaataa

DBGET integrated database retrieval system