KEGG   Raoultella ornithinolytica S12: TE10_16900Help
Entry
TE10_16900        CDS       T03629                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00071  Fatty acid degradation
ron00072  Synthesis and degradation of ketone bodies
ron00280  Valine, leucine and isoleucine degradation
ron00310  Lysine degradation
ron00362  Benzoate degradation
ron00380  Tryptophan metabolism
ron00620  Pyruvate metabolism
ron00630  Glyoxylate and dicarboxylate metabolism
ron00640  Propanoate metabolism
ron00650  Butanoate metabolism
ron00900  Terpenoid backbone biosynthesis
ron01100  Metabolic pathways
ron01110  Biosynthesis of secondary metabolites
ron01120  Microbial metabolism in diverse environments
ron01130  Biosynthesis of antibiotics
ron01200  Carbon metabolism
ron01212  Fatty acid metabolism
ron02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TE10_16900
   00630 Glyoxylate and dicarboxylate metabolism
    TE10_16900
   00640 Propanoate metabolism
    TE10_16900
   00650 Butanoate metabolism
    TE10_16900
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TE10_16900
   00072 Synthesis and degradation of ketone bodies
    TE10_16900
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TE10_16900
   00310 Lysine degradation
    TE10_16900
   00380 Tryptophan metabolism
    TE10_16900
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TE10_16900
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TE10_16900
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TE10_16900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ron04147]
    TE10_16900
Enzymes [BR:ron01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TE10_16900
Exosome [BR:ron04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TE10_16900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJF73629
UniProt: A0A0B5IYT4
Position
3658020..3659216
Genome map
AA seq 398 aa AA seqDB search
MQEVVIVSAARTPVGSFRGAFATLSAVDLGVEVVRGLLARSQLPADAVDELIFGQVLTAG
CGQNPARQTALRAGLSVDTPAVTVNLVCGSGLKAVQQAAQAIRCGDAEIVIAGGQESMSN
AAYLVDGARAGLRFGHTTLLDSMIQDGLWDAFNDYHMGITAENLADEFAITRQRQDAFAA
RSQQKAAAAIEAGRFDNEIIPVSVSQGKKTPRRVEHDEQPRPDTSEEQLAQLRPAFRPQD
GSVTAGNASSLNDGAAAVLLMSADKARELGLPVLGKIVSSAVAGVDPAVMGIGPVSACRL
ALARAGWTLDEVDLIEANEAFAVQALAVGEALGWDSRKVNVNGGAIALGHPIGASGCRIL
VTLLYEMQRRGVSKGLATLCVGGGQGIAMTIEREREAS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaggttgtgattgtcagcgccgccagaacgccggtcggcagctttcgcggcgcc
ttcgccacgctttccgcggtggatctcggcgttgaggtcgtgcgcggcctgctggcccgt
agccagctaccggcggatgcggtcgatgaacttattttcggccaggtgctgaccgccggc
tgcggacaaaacccggcgcgccagacggcgttaagggccgggctgtcggttgataccccg
gcggtgacggtgaacctggtctgcggctccgggctgaaggccgttcagcaggcggcccag
gccatccgctgcggcgacgcggaaatcgtcatcgccggcggccaggagagcatgagcaac
gcggcgtatctggtggatggcgcccgcgccgggctgcgcttcggccacaccaccctgctc
gacagcatgatccaggacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgaaaacctcgccgacgaattcgccattacccgccagcgccaggacgccttcgccgcc
cgctcgcagcaaaaggcggcggcggccatcgaagcgggccgctttgacaatgaaattatc
cccgtcagcgtcagccagggcaaaaagacgccgcggcgggttgagcacgacgagcagccg
cgcccggataccagcgaagagcagctggcgcagctgcgcccggcctttcgcccgcaggac
ggcagcgtcaccgccggcaacgcctcttcgctaaacgacggcgcggcggcggtgctgctg
atgagcgccgacaaagcccgcgagctggggctgccggtgctcggcaaaatcgtcagctcc
gccgtcgccggcgttgacccggcggtgatgggaataggcccggttagcgcctgtcggctg
gcgctggcgcgcgccggatggacgctggatgaggtcgatttaattgaagccaacgaagcc
ttcgccgtgcaggcgctggccgtcggcgaggcgctgggctgggacagccggaaggtgaac
gtcaacggcggcgccatcgccctcggccaccccatcggcgcctccggctgccgcattctg
gtgaccctgctgtatgagatgcagcggcgcggcgtcagtaaaggactggcaaccctctgc
gtcggcggcggacagggcatcgccatgaccattgaacgtgaacgggaggcatcatga

DBGET integrated database retrieval system