KEGG   Raoultella ornithinolytica S12: TE10_17475Help
Entry
TE10_17475        CDS       T03629                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00010  Glycolysis / Gluconeogenesis
ron00071  Fatty acid degradation
ron00350  Tyrosine metabolism
ron00620  Pyruvate metabolism
ron00625  Chloroalkane and chloroalkene degradation
ron00626  Naphthalene degradation
ron00650  Butanoate metabolism
ron01100  Metabolic pathways
ron01110  Biosynthesis of secondary metabolites
ron01120  Microbial metabolism in diverse environments
ron01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ron00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TE10_17475
   00620 Pyruvate metabolism
    TE10_17475
   00650 Butanoate metabolism
    TE10_17475
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TE10_17475
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    TE10_17475
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TE10_17475
   00626 Naphthalene degradation
    TE10_17475
Enzymes [BR:ron01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TE10_17475
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TE10_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AJF73740
Position
3781131..3783809
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IIEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AYKIAELAGFTVPTTTKILIGEVTDVDESEPFAHEKLSPTLAMYRAKNFEDAVNKAEKLV
AMGGIGHTSCLYTDQDNQPARVAFFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKASGVETEVFFEVEADPTLTVVRKGADLANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDVAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTFYGNEFSEGEAAAKKETVAAPKADKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcacttgtagagcgcgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaagttgataagatcttccgtgcagccgctctg
gccgccgctgacgctcgaatccctctcgcaaaaatggccgttgccgaatccggaatgggc
attatcgaagacaaagtgatcaaaaaccacttcgcttctgaatacatctataacgcttat
aaagatgaaaagacctgcggtattctctccgaagacgatacctttggtaccatcaccatc
gcagagcctatcggtattatttgcggtatcgtcccaacgacgaacccaacttctacagca
atctttaaatcactgatcagcctgaaaacgcgtaacgcgatcatcttctctccgcatccg
cgtgctaaagatgccaccaacaaagcggctgacatcgttctgcaggctgcgattgctgcc
ggcgcaccgaaagacctgatcggttggatcgaccagccttccgttgagctctccaacgcc
ctgatgcaccacccagacattaacctgatccttgcgaccggtggtccgggcatggttaaa
gcggcctatagctccggtaaaccggctatcggcgtaggtgcaggtaacacgccggttgtt
attgacgaaaccgctgacattaaacgtgccgttgcgtcggtactgatgtccaaaaccttc
gataacggcgttatctgtgcatctgaacagtccgttgtcgttgttgattccgtctacgac
gccgttcgtgaacgtttcgccagccacggcggctacctgctgcagggcaaagagctgaaa
gcggttcaggacatcatcctgaaaaacggcgcgctgaacgccgctatcgttggtcagccg
gcatacaaaattgccgaactggcaggcttcaccgttccgaccaccaccaaaattctgatt
ggtgaagtgaccgacgttgatgaaagcgagccgtttgctcacgaaaaactgtctccgacc
ctggcaatgtatcgcgccaaaaacttcgaagacgccgtgaataaagctgaaaaactggtg
gcgatgggcggtatcggtcatacctcctgcctgtacaccgaccaggataaccagcctgct
cgcgtggctttcttcggccaaatgatgaaaaccgcacgtattctgattaacaccccggct
tctcagggtggtatcggtgacctgtataactttaagcttgcgccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgtcgtggctctctgccaatcgcactggatgaagtgattactgatggtcacaaa
cgcgcgctgatcgtgaccgaccgcttcctgttcaacaacggctatgctgaccagatcacc
tccgtgctgaaggcatccggcgttgaaaccgaagtgttctttgaagttgaagctgacccg
actctgaccgtggtacgtaaaggtgcagacctggccaactccttcaagccggacgtcatc
atcgccctcggcggtggttcccctatggatgcggcgaaaatcatgtgggtaatgtacgaa
catccggaaacccacttcgaagacctggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcactaccacttccggt
accggttctgaagtgaccccgtttgcggtcgttaccgacgatgcgaccggtcagaaatat
ccgctggcagactacgcgctgacaccggatgtggcgattgtcgatgctaacctcgtcatg
gatatgccgaagtccctgtgtgccttcggtggtctggatgccgttactcacgccctggaa
gcctacgtttccgtactggcatctgagttctccgacggccaggctctgcaggcgctgaag
ctgctgaaagagtacctgccggcgtcctaccatgaaggttctaagaacccggtagcgcgt
gaacgcgtgcacagtgcagcgactattgccggtatcgcgtttgcgaacgccttcctcggc
gtatgtcactcgatggcgcacaagctgggctctcagttccatatcccgcacggcctggcg
aacgccctgctgatttgtaacgttatccgctacaacgcgaacgataacccaaccaagcag
accgcattcagccagtacgaccgtccgcaggctcgtcgccgctacgcagaaattgctgac
cacctgggcctgagcgcacctggtgaccgcactgcagcgaaaatcgagaaactgctggca
tggctggaaagcattaaagctgaactgggtattccgaagtcaattcgcgaagctggcgtg
caggaagctgacttcctggcccacgttgacaagctgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgctatccgctgattgccgaactgaaacagattctgctcgat
accttctacggtaacgagttcagcgaaggcgaagctgccgcgaagaaagagactgttgca
gcaccgaaagccgataagaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system