KEGG   Raoultella ornithinolytica S12: TE10_23005Help
Entry
TE10_23005        CDS       T03629                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ron  Raoultella ornithinolytica S12
Pathway
ron00052  Galactose metabolism
ron00500  Starch and sucrose metabolism
ron01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ron00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TE10_23005
   00500 Starch and sucrose metabolism
    TE10_23005
Enzymes [BR:ron01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     TE10_23005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AJF74740
UniProt: A0A0B5IL60
Position
complement(5022464..5023897)
Genome map
AA seq 477 aa AA seqDB search
MTYSISNAEQELQAKSDALNLRWYPRYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PNDEANLYQVQCLATSRDGIHFERQGIVLDTPPGLHHFRDPKVWREGDSWYMIVGARLGD
VGQVRLYRSADLRQWQDAGVLDEAEKEMGYMWECPDFFALNDRRVLMFSPQGMAAQGYQN
RNLFQSGYLLGDWQPGGTFVREGEFVEMDSGHDFYAPQSFLTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADRRLQMRPAKEVESLRGAWFPWPVSTLKNQQTMLVEKCE
AMEVILRWDSANCSAEQYGLSFGDGLRVYVDAQMQRLVLERHYPQHGLCGARSVPLTAGA
PLSLRIFFDSSSVEVFVNEGEACLSSRIYPDADRRELTLFAWSGSASLSEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacctactcaattagcaacgccgaacaggaactgcaggcgaaaagcgatgcgctgaac
ctgcgctggtacccgcgctaccatcttgccgcccgcgcgggctggatcaacgatcctaac
ggcctggtgtggttcgacggctggtatcacgccttttaccagcaccatccctactcgacg
cagtgggggccgatgcactggggtcatgcgcgcagtaaagatttggtgcactgggagcat
ctgccggtggcgctggcgccggaaggcccggaggataaagatggctgcttctccggctcc
gcggtggtcgacggcgacacgctggcgctgatttataccgggcataaattccacggtgac
ccgaacgacgaggccaacctgtatcaggtgcagtgcctggcgaccagccgcgacggcatc
cactttgagcgccaggggatcgtcctcgataccccgccggggctgcaccatttccgcgat
cctaaggtgtggcgcgagggcgatagctggtacatgatcgtcggcgcgcgcctcggcgat
gtcggccaggtgcgcctgtaccgttcggccgatctgcgccagtggcaggacgcgggcgtg
cttgatgaggcggaaaaagagatgggctacatgtgggagtgcccggacttttttgccctc
aacgacaggcgcgtgctgatgttttctccgcagggaatggcggcgcagggctatcagaat
cgcaacctgttccagagcggctacctgctcggtgactggcagccgggcggcacctttgtg
cgtgaaggcgagttcgttgagatggacagcgggcatgatttttatgcgccgcagagcttc
ctgacgccggacggtcggcggatcgttatcggctggctggatatgtgggagtcgccgctg
ccggagcagcaggacggctgggcggggatgctctcgctgccgcgcgagctgagcctgagc
gccgacaggcggctgcagatgcgcccggcgaaagaggtcgaaagcctgcgcggagcgtgg
ttcccgtggccggtgagcaccttgaaaaaccagcagaccatgctggtggaaaagtgcgag
gcgatggaggttatcctgcgctgggacagcgccaactgtagcgctgagcaatatggcctc
agcttcggcgacggtctgcgggtctacgttgatgcgcagatgcagcgcctggtgctggaa
cgtcactatccgcagcatggcctgtgcggcgcgcgcagcgtgccgttaaccgccggggcg
ccgctcagtctacggatattcttcgacagctcttccgtcgaggtcttcgttaacgagggc
gaagcctgcctcagcagccgtatttatccggatgctgaccgtcgtgaattaaccctattt
gcgtggagcggatcggccagcttatctgaggccggggcctggcagctcgaataa

DBGET integrated database retrieval system