KEGG   Rhodococcus opacus B4: ROP_07380Help
Entry
ROP_07380         CDS       T00882                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00260  Glycine, serine and threonine metabolism
rop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01130  Biosynthesis of antibiotics
rop01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROP_07380 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ROP_07380 (trpA)
Enzymes [BR:rop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ROP_07380 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth DUF1611_N
Motif
Other DBs
NCBI-ProteinID: BAH48985
NITE: ROP_07380
UniProt: C1AT53
Position
complement(776345..777148)
Genome map
AA seq 267 aa AA seqDB search
MSERLSRLAPTFAQCREEKRAALVGYLPAGFPTVPESIDVFKAMVESGCDIVEVGIAYSD
PVMDGPTIQAAAETALQNGVRVRDVFTVVEAIASVGGKAVVMTYWNPVLQYGVDKFARDL
ASAGGLGLITPNLIPEEAGEWIAASKEHDLDRIFLVAPSSTEERLAITLDASSGFVYAAS
TMGVTGARDAVSSMAPELTARIRAHSDIPVGVGLGVRSGAQAAEIAAYADAVIVGSALVT
AAESGLDAVRSLTEELAEGVRSATVAS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacgactctcgcgcctcgccccgacgttcgcgcagtgccgcgaggagaagcgt
gccgcgctcgtcgggtacctcccggccgggttccccaccgtgccggaatccatcgacgtg
ttcaaggcgatggtcgaatccggttgcgacatcgtcgaggtcggcatcgcgtattccgac
ccggtgatggacggacccaccattcaggcggcggccgagacggcgctgcagaacggtgtc
cgggtgcgcgacgtgttcacggtcgtcgaggcgatcgcctccgtcggtgggaaggccgtc
gtgatgacgtactggaaccccgttctgcagtacggcgtcgacaagttcgcccgcgatctg
gcgagcgcaggcggcctcgggctgatcacccccaacctcatccccgaggaagccggcgag
tggatcgccgcgtcgaaggaacacgacctcgaccggatcttcctcgtcgcgccgtcgtcg
accgaggagcgtctcgcgatcaccctcgacgccagcagcgggttcgtctacgccgcgtcc
acgatgggcgtcaccggcgcccgtgacgccgtgtcgtcgatggcgcccgaactgacggcc
cgcatccgcgcccattcggacattccggtgggtgtcggactgggtgtccgctccggcgcg
caggccgccgagatcgccgcctacgccgacgcggtcatcgtcggatccgcgttggtcacc
gcggcggagagcggtctggacgcggtgcgttcgctgacggaggaactcgccgagggcgtt
cgctcggctaccgtggcgtcgtga

DBGET integrated database retrieval system