KEGG   Rhodococcus opacus B4: ROP_08340Help
Entry
ROP_08340         CDS       T00882                                 

Gene name
crtE
Definition
(GenBank) geranylgeranyl pyrophosphate synthase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00900  Terpenoid backbone biosynthesis
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROP_08340 (crtE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rop01006]
    ROP_08340 (crtE)
Enzymes [BR:rop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ROP_08340 (crtE)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ROP_08340 (crtE)
    2.5.1.29  geranylgeranyl diphosphate synthase
     ROP_08340 (crtE)
Prenyltransferases [BR:rop01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ROP_08340 (crtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: BAH49081
NITE: ROP_08340
UniProt: C1AU73
Position
873023..874180
Genome map
AA seq 385 aa AA seqDB search
MVVSTPVARRRSRREREISILEATLSVGTRPAALAAEVENALREFFTSRQALVDAVGGGY
REAVTTLEDFVLRGGKRVRPAFAWTGWLGAGGDPRGPGAGPVLRACSALELVQACALVHD
DIIDASTTRRGFPTVHVEFEEQHRAGRWSGDSAHFGEGVAILLGDLALAWADDMIRESGI
TPDQSARISPVWSAMRTEVLGGQFLDISNEVRADESIDAAMKVNRYKTAAYTIERPLHLG
AALAGADDSLVSAYRRFGTDIGIAFQLRDDLLGVFGDPAVTGKPSGDDLRAGKRTALFAM
SLQRADAEDPAAAALLREGIGTDLSDADVDTLRNMITSLGAVADVEKQIEDLVANALSTL
ATSTATTAAKQQLTEMAVAATRRDY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgtcgacgcccgtcgcccgtcgccggtctcggcgcgaacgcgaaatttcgatc
ctggaggccacactgtccgttggaacgcgccccgccgccctcgcggccgaggtcgaaaat
gcgctgcgcgagttcttcaccagccggcaggccctggtcgacgccgtgggcggcggctac
cgcgaggccgtgacgacgctggaggacttcgttcttcgcggaggcaagcgggtccgtccg
gccttcgcgtggaccggctggctcggggcgggcggcgaccctcggggtcccggggccggg
cccgtgctccgcgcctgctccgcgctggaactcgtgcaggcctgcgccctcgtccacgac
gacatcatcgacgcctccacgacgcgccgcgggttccccaccgtccacgtcgagttcgag
gaacagcaccgcgccgggaggtggagcggtgattccgcccacttcggcgagggcgtcgcc
atcctcctcggcgacctcgcgctggcctgggccgacgacatgatccgcgaatcgggcatc
accccggatcagtcggcccgcatctcccccgtgtggtcggcgatgcgcaccgaggtgctc
ggcgggcagttcctcgacatcagcaacgaggtgcgggcggacgagtcgatcgacgccgcc
atgaaggtcaaccggtacaagaccgcggcgtacaccatcgagcggccgctgcacctcggc
gccgcactcgccggcgccgacgactccctggtctcggcgtaccgccgattcggcaccgac
atcggtatcgccttccagctccgcgacgacctgctgggcgtgttcggggatccggccgtg
accggcaagccgtcgggcgacgacctgcgggcgggcaagcgcaccgccctgttcgcgatg
tcgctgcagcgggccgacgccgaagacccggcggccgccgcactgctccgcgagggcatc
ggcaccgacctgtccgacgcggacgtcgacaccctccggaacatgatcacgtccctcggc
gccgtcgcggacgtggagaagcagatcgaggacctcgtcgcgaacgcgctgtcgacgctg
gcgacgagcaccgccaccaccgcggcgaagcagcagctcaccgagatggccgtcgccgcg
acgcgccgcgactactga

DBGET integrated database retrieval system