KEGG   Rhodococcus opacus B4: ROP_08780Help
Entry
ROP_08780         CDS       T00882                                 

Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00020  Citrate cycle (TCA cycle)
rop00310  Lysine degradation
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
Module
rop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROP_08780
  Amino acid metabolism
   00310 Lysine degradation
    ROP_08780
Enzymes [BR:rop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ROP_08780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAH49125
NITE: ROP_08780
UniProt: C1AUB7
Position
920107..921906
Genome map
AA seq 599 aa AA seqDB search
MVHDHKSTKFNNPNTTVEESKDMAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLE
VSTDKVDTEIPSPVAGVLSKIVAQEDDTVEIGGELAVIGDAGEAPASDSAPAPAAEEPAA
EPAPAAEAPAAEAAPAASGGGSAEGTPVNMPELGESVTEGTVTRWLKAVGDEVAVDEPLV
EVSTDKVDTEIPSPVAGTLLEISAEEDDTVSVGGRLAVIGSGAPAAKPEPKPEPTPEPAK
PAQSPEPAKPEPAKSAPAPAAAPAASAPAPAAAAPAPAATSGDSTPYVTPLVRKLAADNG
VDLSSVTGTGVGGRIRKQDVLAAAEAKKAPAAAAAPAAAPAAAAAPAAASAGVRPELAHL
RGTTQKANRIRQITATKTRESLQTTAQLTQTFEVDVTRIAALRAQAKNTFLEREGVKLTF
LPFFAKAVVEALKSHPNINASYDEANKQITYYDAEHLGFAVDTEQGLLSPVVHNAGDLSL
AGLARAIADIAKRARSGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIV
KRPVVVTDESGSESIGVRSMCYLPLTYDHRLVDGADAGRFLTTIKQRLEQGAFEADLGL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgaccacaagtcgacaaaattcaacaacccgaacacaactgtcgaggagtca
aaagacatggccttctccgtccagatgccagcgcttggtgagagtgtcaccgagggaact
gtcacgcggtggctcaagcaggaaggagacacggtcgaagttgacgaacccttgctcgaa
gtctccacggacaaggtggacacggaaatcccgtctcccgtggccggcgttctcagcaag
atcgttgctcaggaagacgacaccgtcgaaatcggtggcgagcttgccgtgatcggcgac
gccggtgaggctcccgcttccgactccgcacccgcacccgccgccgaggagcccgccgct
gagccggctcccgccgcggaggcaccggccgcagaggccgcacccgcagcgtccggcggc
ggttccgccgagggcaccccggtgaacatgcccgaactgggcgagtccgtcaccgagggc
accgtcacccgctggctcaaggccgtcggcgacgaggtcgccgtggacgagccgctcgtc
gaggtgtccaccgacaaggtcgacacggagatcccgtcgcccgtcgcaggcacgctcctc
gagatcagcgcggaagaggacgacaccgtctccgtcggcggccggctcgccgtcatcggt
tcgggtgcgcccgccgccaagccggagccgaagcccgagcccacccccgagcccgcgaag
cccgctcagtccccggagccggcgaagcccgagcccgccaagagcgcaccggctccggcc
gccgcaccggcagcatccgcgcctgctcccgccgccgcggcacccgctcccgcagcaacg
tccggagacagcaccccgtacgtcaccccgctggtgcgcaagctcgccgcggacaacggc
gtcgacctgtcctcggtgacgggcaccggagtcggtggccgcatccgtaagcaggacgtt
ctcgctgccgccgaggccaagaaggccccggccgccgctgcagcgcccgctgccgcaccg
gccgccgccgctgctcccgccgccgcctccgccggggtccgccccgagctggcgcacctg
cgcggaaccacgcagaaggccaaccggattcgccagatcacggccacgaagacccgggag
tcgctgcagaccacggcgcagctcacccagaccttcgaggtcgacgtcacccggatcgcg
gctctgcgtgcgcaggccaagaacaccttcctcgagcgcgagggcgtcaagctgacgttc
ctcccgttcttcgcgaaggccgtcgtcgaggcgctgaagtcgcacccgaacatcaacgcc
agctacgacgaggcgaacaagcagatcacctactacgacgccgagcacctgggcttcgcg
gtcgacaccgagcagggtctgctgtctccggtcgtccacaacgccggcgacctgtcgctg
gccggcctggcccgcgcgatcgcggacatcgccaagcgcgcccgctccggtgggctcaag
ccggacgagctgtccgggggcacgttcacgatcacgaacatcggcagccagggcgccctg
ttcgacaccccgatcctcgtgccgccgcaggccgcgatgctcggaaccggtgcgatcgtc
aagcgtcccgtggtcgtgaccgacgagtccggcagtgagagcatcggcgtccgctcgatg
tgctacctgccgctcacctacgatcaccgtctcgtcgacggtgccgacgccggccgcttc
ctgaccacgatcaagcagcgtctggagcagggagcgttcgaggccgacctgggtctgtag

DBGET integrated database retrieval system