KEGG   Rhodococcus opacus B4: ROP_09050Help
Entry
ROP_09050         CDS       T00882                                 

Gene name
arsB
Definition
(GenBank) putative arsenite resistance pump
  KO
K03893  arsenical pump membrane protein
Organism
rop  Rhodococcus opacus B4
Brite
KEGG Orthology (KO) [BR:rop00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rop02000]
    ROP_09050 (arsB)
Transporters [BR:rop02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ROP_09050 (arsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsB CitMHS
Motif
Other DBs
NCBI-ProteinID: BAH49152
NITE: ROP_09050
UniProt: C1AUE4
Position
949180..950430
Genome map
AA seq 416 aa AA seqDB search
MTVLAVALVAAVLVFAVVRPRKLPEIVAAAPAAVVVLATGLVTPSQARDEVTEMAPTVGF
LAAILVLAHLADAMGVFTWIAARLRRGARGDPKRLLTLVFGAAALTTAVLSLDATVVLLT
PAVIATARSLRMDPRPHSYASAHLSNTASTLLPVSNLTNLIAFSATGLTFLHFTVVMALP
WAVAIFVELILFRIFFRRHLVPPDAEPEPARDPPAPTVALTIIAATLLGFAVSGFAGVAP
AWVAAAGAIVLGVVALRDGRTDFGRILYAVDVWFCAFVLVLGVVVAGVANGPIGDWIAAR
LPTDTSFAALLAMAVVAAVAANLVNNLPATLLLLAALGPHPPTALVLAMLLGVNLGPNLT
YVGSLAIMLWRRVAARAGSPADLWTFTILALVTTPLTLLAAVVALWACEYFSTAGG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttctcgcggtggcgctcgtcgccgcggtcctcgtcttcgcggtcgtgcgtccc
cgcaagcttcccgagatcgtcgcggccgcaccggccgccgtcgtcgtcctcgcgaccggg
ctggtgacaccgtcgcaggcccgggacgaagtgaccgaaatggccccgaccgtcgggttc
ctcgccgcgatcctcgttctcgcgcacctcgccgacgcgatgggtgtgttcacctggatc
gcggcccggctgcggcgcggggcacgcggagatccgaagaggttgctgacgctcgtgttc
ggagccgcggcactcacgaccgcggtgctgagcctcgacgcgacggtcgtgctgctgacg
cccgccgtgatcgcgacggcccgctcgctgcggatggatccgcggccgcattcgtacgcc
agcgctcacctgtcgaacacggcgtcgaccttgctaccggtctccaatctcaccaacctc
atcgcgttctcggcgaccgggctgaccttcctgcatttcaccgtcgtcatggcgctgccc
tgggcggtggcgattttcgtcgaactgatcctgttccggatcttcttccgccgccacctg
gttccccccgacgccgaaccggaaccggcccgcgatccacccgcaccgaccgtcgcgctg
acgatcatcgccgcaacactcctgggtttcgcggtgtccggcttcgcaggggtcgcgccg
gcgtgggtggcggcggcgggggcgatcgtgctgggcgtcgtcgcgctccgcgacggccgg
accgatttcggccgcatcctgtacgcggtcgacgtgtggttctgcgcgttcgtgctggtg
ctcggcgtcgtcgtcgccggcgtcgcgaacggtccgatcggcgactggatcgctgcgcgg
ctgccgaccgacacctcgttcgcggcgctgctggcgatggccgtcgtcgcggcggtcgcc
gcgaatctggtgaacaacctgcccgccacgctgctcctgctggcggcgctcggacctcac
cccccgacggccctcgtcctggcgatgctgctcggggtgaacctcggccccaacctcacc
tacgtggggtcgctcgcgatcatgctgtggcggcgggtggccgcgcgagccggatcgccc
gcggatctgtggaccttcacgattctcgcgctggtcaccacgccgctcaccttgctcgcg
gcggtcgttgccctctgggcctgtgagtacttctcaaccgcgggcggttaa

DBGET integrated database retrieval system