KEGG   Rhodococcus opacus B4: ROP_09450Help
Entry
ROP_09450         CDS       T00882                                 

Gene name
uppS
Definition
(GenBank) undecaprenyl pyrophosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00550  Peptidoglycan biosynthesis
rop00900  Terpenoid backbone biosynthesis
rop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROP_09450 (uppS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROP_09450 (uppS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rop01006]
    ROP_09450 (uppS)
Enzymes [BR:rop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     ROP_09450 (uppS)
Prenyltransferases [BR:rop01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ROP_09450 (uppS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: BAH49192
NITE: ROP_09450
UniProt: C1AUI4
Position
complement(987159..987968)
Genome map
AA seq 269 aa AA seqDB search
MIRRREPRAPHNSGAERQIRPPDPHPSGARPPGLQPELVPRHIALVMDGNGRWAQERGLP
RTAGHERGEAVLMDAVCGCIEMGVEWLSAYAFSTENWKRSPEEVRFLMGFNRDVIRRRRD
EMHEMGVRVRWAGRRPKLWRSVIKELEIAEELTKHNTVMNLTMCVNYGGRAEIADAAKEI
GRRVAAGQLDPEKITEATVARFLDEPDMPDVDLFLRPSGEQRTSNFLIWQSAYAEMVYQE
KLFPDFDRRDLWAACVEYASRDRRFGGVK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgacgacgcgaaccccgagctccgcataattccggggccgagcgccagatccgg
ccgccggacccgcatccctcgggcgcgcgcccgccgggcctgcaacccgaactcgtgccc
cggcacatcgcgctggtgatggacggtaacggccgctgggcgcaggagcggggactgccc
cggaccgcgggccacgagcgcggcgaggccgtgttgatggacgccgtctgcgggtgcatc
gagatgggtgtcgagtggttgtcggcgtacgcgttctccaccgagaactggaaacgcagc
cccgaggaggtgcgcttcctgatgggcttcaaccgcgacgtgatccgccgccgccgtgac
gagatgcacgagatgggggtgcgggtgcggtgggcgggtcgccggcccaagctgtggcgc
agcgtcatcaaggaactcgagatcgccgaggagctgacgaagcacaacacggtcatgaat
ctgacgatgtgcgtcaactacggcggtcgcgcggagatcgcggacgcggcgaaggagatc
ggcaggcgggtcgcggcgggtcagctcgacccggagaagatcaccgaggcgaccgtcgcc
cgttttctcgacgagccggacatgccggacgtcgacctgttcctccggccgtccggcgag
cagcgcacgtccaacttcctgatctggcagtcggcctacgccgagatggtgtaccaggag
aagctgtttcccgatttcgaccgccgcgacctgtgggcggcgtgcgtggagtacgcgtcg
cgcgatcgccggttcggtggcgtgaaatga

DBGET integrated database retrieval system