KEGG   Rhodococcus opacus B4: ROP_09740Help
Entry
ROP_09740         CDS       T00882                                 

Gene name
cysN
Definition
(GenBank) sulfate adenylyltransferase subunit 1
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00230  Purine metabolism
rop00261  Monobactam biosynthesis
rop00450  Selenocompound metabolism
rop00920  Sulfur metabolism
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
Module
rop_M00176  Assimilatory sulfate reduction, sulfate => H2S
rop_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ROP_09740 (cysN)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ROP_09740 (cysN)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ROP_09740 (cysN)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ROP_09740 (cysN)
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     ROP_09740 (cysN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: BAH49221
NITE: ROP_09740
UniProt: C1AUL3
Position
1017881..1019167
Genome map
AA seq 428 aa AA seqDB search
MSDLLRLATAGSVDDGKSTLVGRLLYDTKSVLADQIDAVTRASVDRGLSTPDLSLLVDGL
RAEREQGITIDVAYRYFATPNRTFVLADTPGHVQYTRNTVSGASTAQLVILLVDARKGVI
SQTRKHAAVLALLGVPKLVLAVNKIDLVEDPATVFADISAEFNSLTSSLGWASEDVVEIP
VSALHGDNVAVRSENTPYYDGPTLIEHLESIPVDAEPHRVGLRFPVQYVIRPRTAEFPDY
RGYAGQVAAGEVTPGDEVVILPSGVRTIVTRIDTADGELDSAHAGRSVTLVLADDVDVSR
GDVIASPADAPEPLGEFDATVCWLAEKPLRPGARLLLKHGTRTTQAIVGTLVERFNEQEL
TSEAAPESLELNEIGKISVRVAEPIVADDYTVNRHTGSFLLIDPAGGNTLAAGLVGDAIA
AVELGERV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcttctgaggcttgccaccgccggcagtgtggacgacggcaagtcgaccctc
gtcggccgtctgctgtacgacacgaaatcagttctcgccgatcagatcgacgccgtcacc
cgggcgtcggtggacaggggactgtccacccccgacctctcgctgctggtcgacggcctg
cgcgcggaacgcgagcagggcatcacgatcgacgtggcgtaccgctacttcgcgacgccc
aaccgcaccttcgtgctcgccgacacccccggtcacgtgcagtacacccgcaacaccgtc
tccggcgcgtccaccgcgcagctggtgatcctgctggtcgacgcgcgcaagggcgtcatc
tcgcagacgcggaagcacgcggccgtcctggcgctgctgggtgtccccaagctggtgctg
gccgtcaacaagatcgacctcgtcgaggacccggccaccgtgttcgcggacatctcggcg
gaattcaactctctgaccagttcgctcggctgggcgtccgaggacgtcgtcgagatcccc
gtatcggccctgcacggcgacaacgtggccgtgcgctccgagaacaccccgtactacgac
ggccccaccctgatcgagcacctcgagtcgatcccggtggacgccgaaccgcaccgggtg
ggtctccgcttccccgtgcaatacgtgatccgtccgcgcacggccgagttcccggactac
cgcgggtacgcgggacaggtcgccgccggtgaggtgaccccgggcgacgaggtcgtgatc
ctgccgtcgggtgtgcgcaccatcgtcacccggatcgacacggcggacggcgagctcgac
agcgcccacgccggccgcagcgtcaccctcgtgctggccgacgacgtcgacgtctcccgc
ggcgacgtcatcgcctctcccgccgacgccccggagccgctcggtgagttcgacgcgacc
gtctgctggctggcggagaagccgctgcgccccggtgcccgcctgctgctcaagcacggc
acccgcaccacgcaggccatcgtgggcacactcgtcgagcgtttcaacgagcaggagctg
acgtcggaggccgccccggagtcgctggagctcaacgagatcggcaagatctcggtgcgt
gtcgcggagccgatcgtcgccgacgactacaccgtgaaccgccacaccggcagcttcctg
ctgatcgatccggccggcggcaacacgctcgcggccggcctcgtcggagatgcgatcgca
gcggtggagctcggcgagcgcgtctag

DBGET integrated database retrieval system