KEGG   Rhodococcus opacus B4: ROP_10250Help
Entry
ROP_10250         CDS       T00882                                 

Gene name
rbsK
Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ROP_10250 (rbsK)
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ROP_10250 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: BAH49272
NITE: ROP_10250
UniProt: C1AVJ2
Position
1070292..1071158
Genome map
AA seq 288 aa AA seqDB search
MSAPRVAVVGSVNMDLLTATERLPGPGETILGSAFAATPGGKGANQAIAAARAGGAVTFI
GAVGSDVFALDLRQALVDAEVDTRYLREVDGPSGIAAITVDAAGENSIVVVPGANSTVAD
LTPAELAAVADADVLLCQLEIPLGTVVAAATHAAAHGTVVMVNPSPAQTLPPELVELIDV
LLVNQTEAAQLGAEVTGAVSHVVTTLGSSGADYAGRDGAALHADSPVVEVVDTTGAGDAF
AGALSVSWRGGPETAVPFACTAGALATTRRGASTSSPTLAEIEAALAG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcccagggtcgccgtggtcggcagcgtcaacatggatctgctgacggcgacc
gagcggttgcccgggcccggggagacgatcctgggcagcgccttcgccgccacccccggc
ggaaagggcgccaaccaggcgatcgccgcggcgcgggcgggcggggccgtgacgttcatc
ggcgcggtcggctccgacgtgttcgccctcgacctgcggcaggccctcgtcgacgccgag
gtcgacacccggtacctgcgggaggtcgacgggccgagcgggatcgcggcgatcacggtc
gacgccgccggggagaacagcatcgtcgtggtgccgggcgccaacagcaccgtggcggac
ctgacacccgccgaactcgcggcggtcgcggacgccgacgtcctgctctgccaactcgag
atacccctgggcaccgtggtggccgccgcgacgcacgccgcggcccacggcaccgtggtg
atggtgaatccgtcaccggcgcagacacttccacccgagctcgtggagctgatcgacgtg
ctgctggtgaaccagaccgaggccgcgcaactcggcgccgaggtcaccggcgccgtctcc
cacgtcgtcaccacgctggggtcgtcgggcgcggactacgcgggccgcgacggtgccgcg
ctccacgccgactccccggtggtcgaggtggtcgacacgaccggcgcgggcgacgccttc
gcgggcgccctcagcgtgtcgtggcgcggcggccccgagaccgccgtcccgttcgcgtgc
acggcgggcgcactcgcgaccacccgccgcggcgcgtccacgtcgtctcccaccctcgcc
gagatcgaggcggccctggccggctga

DBGET integrated database retrieval system