KEGG   Rhodococcus opacus B4: ROP_18920Help
Entry
ROP_18920         CDS       T00882                                 

Gene name
def
Definition
(GenBank) peptide deformylase
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
rop  Rhodococcus opacus B4
Brite
KEGG Orthology (KO) [BR:rop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ROP_18920 (def)
Enzymes [BR:rop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     ROP_18920 (def)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pep_deformylase
Motif
Other DBs
NCBI-ProteinID: BAH50139
NITE: ROP_18920
UniProt: C1B0D9
Position
2007654..2008244
Genome map
AA seq 196 aa AA seqDB search
MAILPIRIVGDPVLHEPTETVSESPAELSELIADMYDTMDAANGVGLAANQVGIPLRLFV
YDCPDVDETGKPFRRRGCVVNPVLETSERPETMPDPDDDVEGCLSVPGEQFPTGRAEWAK
VTGTDADGNAVEIEGRDFFARMLQHEVGHLDGFLYVDMLVGRNARAAKKTIKRAGWGVPG
LSWVPGTVEDPFGHDD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggccatcctccccatccggatcgtgggcgacccggtattgcacgaaccgaccgagacg
gtgtccgagtcaccggcagaactctccgaacttatagcggacatgtacgacacgatggac
gccgccaacggcgtcgggctcgccgccaaccaggtcggaataccgctgcggttgttcgtc
tacgactgccccgacgtcgacgagaccggcaagccgttccgccgccggggatgcgtcgtc
aacccggtcctcgagacgtcggaacggcccgagaccatgccggacccggacgacgacgtc
gagggctgcctgtccgttcccggcgagcagttccccaccggccgcgccgagtgggcgaag
gtcaccggcaccgacgccgacggcaacgccgtcgagatcgagggacgcgacttcttcgcg
cgcatgctgcagcacgaggtcggtcacctcgacggtttcctctacgtcgacatgctggtc
ggccgtaacgcacgcgccgccaagaagaccatcaagcgcgcgggctggggagttcccggt
ctcagctgggtgccgggaacggtcgaagacccgttcgggcatgacgactga

DBGET integrated database retrieval system