KEGG   Rhodococcus opacus B4: ROP_22020Help
Entry
ROP_22020         CDS       T00882                                 

Definition
(GenBank) putative oxidoreductase
  KO
K19181  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) [EC:1.1.1.292]
Organism
rop  Rhodococcus opacus B4
Brite
KEGG Orthology (KO) [BR:rop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ROP_22020
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.292  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming)
     ROP_22020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C
Motif
Other DBs
NCBI-ProteinID: BAH50449
NITE: ROP_22020
UniProt: C1B225
Position
2358496..2359479
Genome map
AA seq 327 aa AA seqDB search
MRWAILGASNVAATRVLPALRECGQTAAVVLSGDPSRAEDYRRTHGIESATGDLREAVGG
DVRAAYISSTNDKHFEHAMAAIDAGLHVLCEKPLSFDIAQAQKMVDAAAAAGVVFATNHH
LRNHPVHRAARKLLAEGAIGDILSVRVGNAIMLRQALRGWRLDGVGGGVVLDLAVHDIDT
LRFVTGMEPATVTAVGVCQGLSDGPADAVMTSGILGSGTLFSLHDAYTVPGAVTGFEIHG
TAGTLAAEDCMRPDPTGTLRMIRDGDGTTVPLETVDNLYAPGIRAFVDAVRGVGEPVATG
LDGLRSVTAALAILRSIEEGRAVRVAT
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagatgggcgattctcggcgcgagcaatgtcgcggccacccgcgtgctgcccgcgttg
cgcgagtgcgggcagacggcggcggtggtgctcagcggtgatccgtcgcgcgcggaggac
taccggaggacccacggcatcgagtccgccaccggcgacctgcgcgaggcggtgggcggc
gacgtccgggccgcgtacatctcctccaccaacgacaagcacttcgagcacgccatggcc
gcgatcgacgcgggcctgcacgtgctgtgcgagaagcctctctcgttcgacatcgctcag
gcgcagaagatggtcgacgcggccgcagccgcgggggtggtgttcgcgacgaaccatcac
ctccgcaatcaccctgtccaccgcgcagcccgaaagttgctggccgagggcgcgatcggc
gacattctgtcggtgcgcgtcggcaatgccatcatgctgcgccaggccctgcgcggatgg
cgtctcgacggcgtcggcggcggagtcgtcctcgacctcgcggtgcacgacatcgacact
ctccgcttcgtcaccgggatggaaccggccacggtcacggcggtgggcgtgtgccaggga
ctcagtgacggtccggcggacgccgtgatgacgagcggcatcctcggctccggcaccctg
ttctcgctgcacgacgcgtacacggtccccggcgccgtgaccggattcgaaatccacgga
acggcaggcactctcgccgccgaagactgcatgcgccccgaccccaccggaacgctgcgc
atgatccgggacggagacggcaccaccgtcccgctcgaaaccgtcgacaacctgtacgcg
ccggggatccgggccttcgtcgacgccgtccgcggggtcggtgaaccggtggcgaccggg
ctcgacggactgcggtcggtgaccgccgcgctggcgatcctgcggtcgatcgaggagggc
cgggcggtccgggtcgctacatga

DBGET integrated database retrieval system