KEGG   Rhodococcus opacus B4: ROP_42140Help
Entry
ROP_42140         CDS       T00882                                 

Definition
(GenBank) putative oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00984  Steroid degradation
rop01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ROP_42140
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     ROP_42140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N FAD_binding_2 Pyr_redox_2 NAD_binding_8 GIDA HI0933_like Pyr_redox FAD_binding_3 FAD_oxidored Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: BAH52461
NITE: ROP_42140
UniProt: C1B9V8
Position
4540655..4542367
Genome map
AA seq 570 aa AA seqDB search
MTHYDVVVVGSGFGGSVAALRLTEKGYRVGVLEAGRRFADDELPETSWRLRRYLWAPWLG
CYGVQRIHLLPDVLVMAGAGVGGGSLNYANTLYQPPRRFFEDRQWAHITDWQAELAPYYE
QAKRMLGVTTNPSFTPADAVMREVAEEMGAGATFTSTPVGVFFGEPGARVADPFFGGQGP
DRTGCTECGSCMTGCRVGAKNTLVKNYLHLAEKAGARVHPLTTVKELRPRPGGGYELWTR
RTDGIRKREHTFTADQVVVAAGTYGTARLLLAMKESGALPRLSPRLGSVVRTNSEAVLAA
TARNRDTDFTKGVAITSSFHPDDHTHIEPVRYGKGSNAIGLLQTVLSDGGGRTPRLLKTV
GVALRRPGAFARSLSVRHWSERTVIALVMQTDDNSLELAKGKGRFGRAVTSRPGPGDPPP
EWIPQGHTAIRKVADRIGGDPGGSFADVVNIPMTAHFLGGCAIGDSPDTGVVDPYLRAYG
HDGLHVADGSVVSANLGVNPSLTITAQAERAFALWPNKGEKDTRPEPGKPYVRIAPSPPR
SPVVPAGAPGALRLPLTVVNRRETTDVERA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacgcactacgacgtggtcgtcgtcggctccggtttcggcggcagcgtcgcggcactc
cggctcaccgagaagggctaccgggtcggcgttctcgaggcaggcaggcgcttcgccgac
gacgaactgcccgaaacgagctggaggttgcggcgctacctgtgggcgccgtggctgggc
tgttacggcgtgcagcgaatccacctcctccccgacgtcctggtcatggccggggccggg
gtcggcggcggttcgctcaactacgcgaacacgctgtaccagccgccgcgccgattcttc
gaggaccggcagtgggcgcacatcaccgactggcaggcggagctggccccgtactacgag
caggcgaagcggatgctgggggtgacgaccaatccgtcgttcacccccgccgacgccgtc
atgcgcgaggtcgccgaggagatgggcgccggtgcgacgttcacgtccacaccggtgggt
gtcttcttcggcgaaccgggggcgcgggtggccgacccgttcttcggcgggcagggtccc
gaccggacggggtgcaccgagtgcggcagttgtatgacgggttgccgtgtgggagcgaag
aacacgctcgtcaagaattacctccatctcgcggagaaggcgggcgcccgggtccatccg
ctgacgacggtgaaggaattgcgaccccggcctggcggcggctacgagttgtggacccgc
cgcaccgacggaatccgcaagcgggagcacacgttcaccgccgaccaggtggtggtcgct
gccggcacgtacggtaccgcccggctgctgctggcgatgaaggaatccggtgcgctgcca
cggttgtcgccgcggctggggtcggtggtgcgcaccaactcggaggcggtgctcgcggcc
acggccaggaaccgcgacaccgacttcacaaagggcgtggccatcacgtcctcgttccac
ccggatgatcacacccacatcgagccggtgcggtacggcaagggcagcaacgcgatcgga
ctgttgcagaccgtcctcagcgacggcggcggccggacgccgcggttgctgaaaacggtc
ggcgtcgcgctgcgccgccccggggcgttcgcccgcagcctgtcggtgcggcactggtcg
gagcgcaccgttatcgcgctcgtgatgcagacggacgacaattcgctcgaactcgccaag
gggaagggtcggttcgggcgcgcggtcaccagccgtccggggcccggggatccgccgccc
gaatggatcccgcagggtcacacggcgatcaggaaggtggccgatcggatcgggggagac
ccgggcggttcgttcgccgacgtcgtcaacattccgatgaccgcgcatttcctcggggga
tgcgccatcggggactcgccggacaccggtgtcgtcgacccctacctgcgtgcatacggg
cacgatgggctgcacgtggccgacgggtcggtggtgagcgcgaacctcggcgtcaacccg
tcgctcaccatcaccgctcaggccgagcgcgcattcgcgctgtggcccaacaagggcgag
aaggacactcggcccgagcccggcaagccatacgtacgtatcgcaccgtcgccgccccgg
agtccggtggtgcccgccggcgcgcccggcgcgctgcggcttccactgacggtcgtgaac
cgaagggagacaaccgatgtggagcgtgcctga

DBGET integrated database retrieval system