KEGG   Rhodococcus opacus B4: ROP_47770Help
Entry
ROP_47770         CDS       T00882                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00071  Fatty acid degradation
rop00072  Synthesis and degradation of ketone bodies
rop00280  Valine, leucine and isoleucine degradation
rop00310  Lysine degradation
rop00362  Benzoate degradation
rop00380  Tryptophan metabolism
rop00620  Pyruvate metabolism
rop00630  Glyoxylate and dicarboxylate metabolism
rop00640  Propanoate metabolism
rop00650  Butanoate metabolism
rop00900  Terpenoid backbone biosynthesis
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
rop01212  Fatty acid metabolism
rop02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROP_47770
   00630 Glyoxylate and dicarboxylate metabolism
    ROP_47770
   00640 Propanoate metabolism
    ROP_47770
   00650 Butanoate metabolism
    ROP_47770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ROP_47770
   00072 Synthesis and degradation of ketone bodies
    ROP_47770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROP_47770
   00310 Lysine degradation
    ROP_47770
   00380 Tryptophan metabolism
    ROP_47770
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROP_47770
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_47770
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROP_47770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rop04147]
    ROP_47770
Enzymes [BR:rop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ROP_47770
Exosome [BR:rop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ROP_47770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Phage_lysis
Motif
Other DBs
NCBI-ProteinID: BAH53024
NITE: ROP_47770
UniProt: C1BBH1
Position
complement(5135751..5136914)
Genome map
AA seq 387 aa AA seqDB search
MGTPVIVEAVRTPIGKRGGWLSGLHAAEILGAAQRGILDRSGIDPELVEQVIGGCVTQAG
AQSNNITRTAWLHAGLPWQVGATTIDCQCGSAQQANHLIAGLIATDAIDVGIACGIEAMS
QVPLGANVGENAGPRRPADWDIDMPNQFEAAERIARRRGITRADVEALGVRSQARAKQAW
DEGRFDREVLQVTAPVVDKDGNLTGETRVVSRDQGLRDTTAESLARLKPVLEGGIHTAGT
SSQISDGAAAVMLMDEARARALGLKPRARIISQALVGSEPEFHLDGPVQATARVLERSGM
KIGDLDLFEVNEAFASVLLSWASVHQPDMDRVNVNGGALALGHPVGSTGSRLITTALHEL
ERTDGSTALITMCAGGALATGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacacccgtcatcgtcgaggcagttcgcacccccatcggaaagcgcggtggctgg
ctgtccggattgcacgccgccgagatcctcggcgccgctcagcggggcatcctcgaccgc
tcgggcatcgaccccgaactggtggagcaggtgatcggcggttgcgtcacccaggccggt
gcgcaatcgaacaacatcacccgcaccgcatggctgcacgccggactgccctggcaggtc
ggcgccaccacgatcgactgccagtgcggctccgcccagcaggccaaccatctgatcgcg
ggcctgatcgccacggacgcgatcgacgtcggaatcgcctgcggcatcgaggccatgagc
caggtgccgctcggggcgaacgtcggggagaacgccggcccccgcaggcccgccgactgg
gacatcgacatgcccaatcagttcgaggccgccgagcgtatcgcccgccgccgcggaatc
acccgcgccgacgtcgaggctctcggggtgcgttcgcaggcacgcgccaagcaggcgtgg
gacgaaggacgattcgaccgggaggtgctgcaggtgacggcacccgtcgtggacaaggac
ggcaacctcaccggggaaacccgggtcgtcagccgcgatcagggtctgcgcgacaccacc
gcggagtccctcgccaggctgaagcccgtactcgagggcggcatccacaccgcgggcacg
tcgtcgcagatctccgacggcgccgccgccgtcatgctgatggacgaggccagggcgcgc
gccctcggcctgaaacctcgggctcgcatcatctcccaggcgctcgtcggttccgaaccc
gaattccacctcgacggacccgtccaggccaccgcacgcgtcctcgaacgcagcggcatg
aagatcggcgacctcgacctgttcgaggtgaacgaggccttcgcgtcggtcctgctgtcg
tgggcctcagtacaccagcccgacatggacagggtcaacgtcaacggcggagcgctcgcg
ctcggacaccccgtgggcagcaccgggtcccggctcatcaccacggcgctgcacgaactc
gagcgcaccgacgggtcgacggcactgatcacgatgtgcgccggcggagcactcgccacc
ggcaccatcatcgagcggatctag

DBGET integrated database retrieval system