KEGG   Rhodococcus opacus B4: ROP_56970Help
Entry
ROP_56970         CDS       T00882                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00040  Pentose and glucuronate interconversions
rop00052  Galactose metabolism
rop00500  Starch and sucrose metabolism
rop00520  Amino sugar and nucleotide sugar metabolism
rop01100  Metabolic pathways
rop01130  Biosynthesis of antibiotics
Module
rop_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ROP_56970 (galU)
   00052 Galactose metabolism
    ROP_56970 (galU)
   00500 Starch and sucrose metabolism
    ROP_56970 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ROP_56970 (galU)
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ROP_56970 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75 IspD
Motif
Other DBs
NCBI-ProteinID: BAH53944
NITE: ROP_56970
UniProt: C1AX21
Position
6225868..6226788
Genome map
AA seq 306 aa AA seqDB search
MTDAAPHTASAFRTAVVPAAGMGTRFLPATKTVPKELLPVVDTPGIELVAGEAADSGAGR
LVIVTSPGKDGVVAHFVEDLVLESKLEASGKYHLLEKVRKAPGLLEVESVVQDQPLGLGH
AVGCAESVLDEDEDAIAVLLPDDLVMPRGVLETMSRVRRKRGGTVLCAIDVPKDQVSAYG
VFEVETVPDAVNPDVLKVTGMVEKPAIEDAPSTFAAAGRYLLDRAIFDALRRIEPGAGGE
LQLTDAIALLIKEGHPVHVVVHRGTRHDLGNPGGYLRAAVDFALDMEEYGPSLREWLIDR
LKRTES
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgccgccccgcacaccgccagcgcctttcgcacggctgtcgtgcccgcagcg
ggaatggggacgcgattccttcccgcgaccaagaccgtgccgaaagagctgctcccggtc
gtggatacccccggtatcgaactcgtggccggagaagctgccgattcgggtgccggccgg
ctcgtgatcgtcacgtcgcccggtaaggacggagtggtcgcccacttcgtcgaggacctc
gtgctcgagagcaagctcgaggccagcggcaagtaccacctgctcgaaaaggtgcgcaag
gctcccggcctgctcgaggtggagtccgtcgtccaggaccagcccctcggcctcggccac
gcggtcggctgcgcggagtcggtcctcgacgaagacgaggacgccatcgccgtgctcctc
ccggacgacctggtgatgccgcgcggcgtgctcgagacgatgtcccgggtccgccgcaag
cgcggcgggaccgtgctctgcgccatcgacgtccccaaggaccaggtgagcgcgtacggc
gtcttcgaggtcgaaacggtgcccgacgccgtcaacccggacgtcctcaaggtcaccgga
atggtcgagaagcccgccatcgaggacgccccgtcgacgttcgcggccgccggtcgctac
ctcctcgaccgtgccatcttcgacgcgctgcggcggatcgaacccggcgccggcggcgag
ctccagctcaccgacgccattgccctcctcatcaaggaaggccaccccgttcacgtcgtc
gtgcaccggggcacgagacacgatctcggaaatcccggcggctacctccgtgctgcggtt
gactttgcgttggacatggaagagtacggcccgtcgttgcgagaatggctgatcgaccga
ttgaagcggacggaatcctag

DBGET integrated database retrieval system