KEGG   Rhodococcus opacus B4: ROP_60330Help
Entry
ROP_60330         CDS       T00882                                 

Definition
(GenBank) putative rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
rop  Rhodococcus opacus B4
Brite
KEGG Orthology (KO) [BR:rop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rop03009]
    ROP_60330
Enzymes [BR:rop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ROP_60330
Ribosome biogenesis [BR:rop03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ROP_60330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_31 zf-RRN7
Motif
Other DBs
NCBI-ProteinID: BAH54280
NITE: ROP_60330
UniProt: C1AZK9
Position
6593800..6594636
Genome map
AA seq 278 aa AA seqDB search
MLADVTDLLACPQCRSGVELDEGTILCDAGHTFDVARQGYVTLMTGAGGKFDGDSPEMIA
ARADFLAGGSFDPLMDAVADAVVAGAGDDPRILEIGAGTGHYLARVLDAAPAGRGIGLDV
SKYAARRIARAHPRAGAVVADVWQHLPVRDHVLSHVLCVFAPRNADEAHRVLAEHGSLVV
LTPTDRHLGELVDLLGMVRVDDRKVERLGAAMSGRFERTDHVAVEYPMSLSHLDVTRLVG
MGPSARHLTPDRLASSIAALPQEYPVTASVTVSTYTRL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccgatgtgaccgacctgctggcctgcccgcagtgccggtcgggggtggaactc
gacgaaggcacgatcctgtgcgacgcaggacacaccttcgacgtggcgcgtcagggctac
gtcaccctgatgaccggggccggtggcaagttcgacggcgacagccccgaaatgatcgcc
gcacgtgcggacttcctcgccggcggcagcttcgacccgctgatggatgccgtcgccgac
gcggtggtggcgggcgccggggacgatccccggatcctcgagatcggcgcgggcacaggc
cactacctggcgcgtgtcctcgacgccgccccggccggccggggaatcgggctggacgtg
tccaagtacgcggcccgtcgcatcgccagggcccacccgcgtgccggggcggtggttgcc
gacgtgtggcaacaccttccggtgcgtgaccacgtcctcagtcatgtcctgtgcgtgttc
gcgccccgcaacgccgacgaggcgcaccgggtgctggccgagcacggctccctggtggtc
ctcacgcccacggaccggcatctgggggaactggtggacctgctcggcatggtccgggtg
gacgaccgcaaggtcgagcggctcggggccgcgatgtccgggcggttcgagcgcaccgac
cacgtggccgtggagtatccgatgtcgttgtcgcacctcgacgtgacgcgcctggtcggg
atggggccgtcggcgcggcacctgacacccgaccggctcgcatcctcgatcgccgcgctg
ccgcaggaatatcccgtgacggcgtcggtgaccgtgtccacctacacacggctctga

DBGET integrated database retrieval system