KEGG   Rhodococcus opacus B4: ROP_62610Help
Entry
ROP_62610         CDS       T00882                                 

Definition
(GenBank) putative oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00984  Steroid degradation
rop01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ROP_62610
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     ROP_62610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 Fer4_10 Fer4_21 Fer4
Motif
Other DBs
NCBI-ProteinID: BAH54508
NITE: ROP_62610
UniProt: C1B113
Position
6864231..6865973
Genome map
AA seq 580 aa AA seqDB search
MSKKRTTDYDVLIVGSGFGGSVTALRLVEKGYKVGILEAGRRYADADFAKTSWDLKKFLW
APALGFFGIQRVHLLRDCLILAGAGVGGGSLNYANTLYKPPASFFQDKQWSHITDWHDEL
TPYYEQARKMLGVVQNPHMTPADEIIKSVAEDMGVGDTFIQTPVGVFFGEAGKTVPDPYF
GGVGPDRTGCIECGECMTGCRHGAKNTLLKNYLGLAEKAGAEIVPMTTVTGLREASDGTW
DVFTRRSGPRKNRNRKTYTAANVVLAAGTWGTQHLLFDQKESGALPKISDRLGVLTRTNS
ESILGAAKNKVDPALELTKGVAITSSFHPTSDTHVEPVRYGKGSNSMAMLQTLLTDGGGR
RWMTFLRELAKDPTALKVLTPYKWSERTIIALVMQNLDNSITTYTKKGLFGRRKVTSRQG
HGQPNPSWIPAGNEATRRIAEKIDGRAGGTWGDVFNIPLTAHFLGGCTIASEPSNGVIDP
YHRVWGYPTLSVVDGSAVSANLGVNPSLTISAQAERAASLWPNKGEADLRPEQGEGYRRL
NPIAPVKPVVPEGAPAALVLPIVEIRSGSVLPDTQKHGVA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagcgcacaacggattacgacgttctcatcgtcggttccggattcggtggc
agcgtcaccgcactccggttggtcgagaagggttacaaggtcggcatcctcgaggcgggc
cgccgctacgccgacgccgacttcgcgaagaccagctgggatctcaagaagttcctgtgg
gcgcccgccctcggtttcttcggcatccagcgcgtccacctgctccgcgactgcctcatc
ctcgccggcgccggcgtcggcggcggctcactcaactacgcgaacaccctctacaaaccg
cccgcctccttcttccaggacaagcagtggtcgcacatcaccgactggcacgacgagctc
acgccgtactacgagcaggcccgcaagatgctcggagtcgtccagaacccgcacatgacg
cccgcggacgagatcatcaagtcggtcgccgaggacatgggcgtgggcgacacgttcatc
cagaccccggtcggcgtcttcttcggtgaagcgggcaagaccgtgcccgacccctacttc
ggcggcgtcggccccgaccgcaccggatgcatcgaatgcggcgaatgcatgaccggatgc
cgtcatggcgccaagaacaccctgctcaagaattacctgggcctcgcggagaaggccggc
gcggagatcgtcccgatgacgacggtcaccggtctgcgcgaggcgtccgacggcacctgg
gacgtcttcacccggcgcagcgggccgcggaagaaccggaaccgcaagacgtacaccgcc
gcgaacgtcgtcctggcggccgggacgtggggtactcagcatctgctgttcgaccagaag
gagtcgggcgcgctgcccaagatctccgaccggctgggtgtgctgacccgcaccaactcg
gagtcgatcctcggcgccgccaagaacaaggtggatcccgcgctcgagctcaccaagggc
gtcgccatcacgtcgtcgttccacccgacgtccgacacccacgtggagccggtgcgctac
ggcaaggggtcgaactcgatggccatgctgcagacgctgctgaccgacggcggcgggcgg
cggtggatgacgttcctccgggaactggcgaaggatccgacggccctgaaggtcctcacc
ccgtacaagtggagcgagcgcaccatcatcgcgctggtgatgcagaacctcgacaactcc
atcaccacatacacgaagaagggcctgttcggccggcgcaaggtcaccagcaggcagggc
cacggtcagccgaaccccagctggatccccgcgggcaacgaggcgacccggcggatcgcc
gagaagatcgacggtcgcgccggcggtacctggggagatgtgttcaacattccgctcacc
gcgcactttctcggcggctgcaccatcgcctcggagccgtcgaacggcgtcatcgacccg
taccaccgggtgtggggttacccgacgctgagtgtggtcgacggttcggcggtgtccgcg
aacctgggcgtcaacccgtcgctgacgatctcggcgcaggccgagcgtgcggcgtcgctg
tggccgaacaagggcgaggcggacctgcgtccggagcagggggagggataccggcggctg
aacccgatcgcgccggtcaagccggtcgtcccggaaggcgcgcccgccgcgctggtgctg
ccgatcgtcgagatccgaagcggctccgtgttgcccgacacccagaagcacggcgttgcg
tag

DBGET integrated database retrieval system