KEGG   Rhodococcus opacus B4: ROP_65120Help
Entry
ROP_65120         CDS       T00882                                 

Definition
(GenBank) glucosyltransferase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00500  Starch and sucrose metabolism
rop01100  Metabolic pathways
Module
rop_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROP_65120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rop01003]
    ROP_65120
Enzymes [BR:rop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ROP_65120
Glycosyltransferases [BR:rop01003]
 Polysaccharide
  Storage polysaccharide
   ROP_65120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_trans_4_2 KR
Motif
Other DBs
NCBI-ProteinID: BAH54759
NITE: ROP_65120
UniProt: C1B1R4
Position
complement(7123485..7124729)
Genome map
AA seq 414 aa AA seqDB search
MKILIVSWEYPPVVVGGLGRHVHHLATELAAAGHEVVVLSRRPSGTDASTHPTVTHIEDG
VLVVAVAEDPAHFVFGEDMLAWTLAMGHAMVRAGVALHKPGVGEGWQPDVVHAHDWLVAH
PAIALAEFYDVPLVSTLHATEAGRHSGWVSGRINRQVHSVEWWLANESDALITCSASMQD
EVTALYGPQLPPITVIRNGIDLTTWSFRERAPRSGPPKLLFVGRLEYEKGVQDAIAALPR
IRRSHPGTTLSIAGEGTQFTWLYQQARTHRVARAVHFLGNLDHIELLGWLHGADAIVLPS
RYEPFGIIALEAAASGTPLVASTAGGLGEAVVDGDTGMSFQPGDVTGLTSAVREVLDDPA
GAQQRAVAARDRLTADFDWHKVAEETVHVYAGAKRRVRHPLARPEIPERPLPGR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcctgatcgtgtcatgggagtacccacccgtcgtggtcggcggtctgggccgc
cacgtccaccacctggccaccgaactcgccgccgcgggacacgaagtggtggtgctgtcg
cggcggccgtcgggcaccgatgcgtcgacccatcccaccgtcacccacatcgaggacggc
gtcctggtggtcgccgtcgccgaagaccccgcgcacttcgtgttcggcgaggacatgctg
gcgtggacactcgcgatggggcacgcgatggtgcgggccggtgtggcattgcacaagccg
ggcgtcggggagggctggcagccggacgtggtgcacgcgcacgactggctggtggcgcat
ccggccatcgcgttggccgaattctacgacgtccctttggtttccacgctccacgccacc
gaggccgggcggcacagcggctgggtgtcgggccggatcaaccggcaggtgcattcggtg
gaatggtggctcgccaacgaatccgacgcgctcatcacgtgttccgcgtcgatgcaggac
gaggtgaccgcactctacggtccgcagctcccgccgatcacggtgatccgcaacggaatc
gacctcaccacgtggagtttccgggagcgcgcgccgcggtccgggccgccgaaactactg
ttcgtcggccgcctcgaatacgagaagggcgtgcaggacgccatcgccgcgcttccccgc
atccgccgcagccaccccgggacgacactgtcgatcgccggggagggcacccagttcacg
tggctctaccagcaggcccgcacccatcgcgtcgcccgcgcggtgcacttcctcggcaac
ctcgaccacatcgaactgctcgggtggctgcacggcgccgacgccatcgtcctgcccagc
cggtacgagccgttcggcatcatcgcgctcgaggccgccgcctccggaaccccgctcgtc
gcgtccaccgcaggcgggctcggggaagcggtcgtcgacggcgacaccggcatgtcgttc
cagccgggcgacgtcaccggactcacgtccgcggtccgggaggtgctcgacgacccggcc
ggtgcgcagcagcgcgcggtggccgcccgcgaccggctcaccgccgatttcgactggcac
aaagtggccgaggagacggtccacgtctacgcgggcgccaaacgtcgcgtgcggcacccg
ctggcgcggccggagattcccgagcgtcccctgcccggccgctga

DBGET integrated database retrieval system