KEGG   Rhodococcus opacus B4: ROP_68090Help
Entry
ROP_68090         CDS       T00882                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00010  Glycolysis / Gluconeogenesis
rop00520  Amino sugar and nucleotide sugar metabolism
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
Module
rop_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_68090 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    ROP_68090 (ppgK)
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     ROP_68090 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAH55056
NITE: ROP_68090
UniProt: C1B467
Position
complement(7429025..7429777)
Genome map
AA seq 250 aa AA seqDB search
MAKTGFGVDVGGSGVKGGVVDLETGELIGDRIKLLTPQPSTPEAVAKTVAEIIRQAGWDG
PVGITLPSVVTGGVARSAANIDKGWIGTDARALFSDALGGTRVTVLNDADAAGMAEDALG
AGKDAKGVVILLTFGTGIGSAILHDGVLLPNTEFGHMEVDGKEAEHRAASSVKEKKDLSY
KEWAAEVSRVLTRFENLLWPDLFIAGGGISRKHEKWIPHLTNRTPVVPAALLNTAGIVGA
ALAVETGIAP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaacggggttcggtgtcgacgtcggaggcagcggcgtcaagggtggcgtcgtc
gatctcgagaccggtgagctgatcggcgaccgcatcaagctcctcaccccccagccgtcc
accccggaggcggtcgcgaagaccgtcgcggagatcatccgccaggcaggatgggacgga
ccggtcggtatcacgctgccgagcgtcgtcaccggcggcgtcgcacgatcggccgcgaac
atcgacaaggggtggatcgggaccgacgcgcgcgcgctgttctcggacgcactcggcggc
acgcgcgtcaccgtcctcaacgacgcggacgcggcggggatggccgaggacgcgctcggc
gcgggcaaggacgcgaagggggtcgtcatcctcctcacgttcggcacgggcatcggctcg
gcgatcctccacgacggcgtgctgctccccaacaccgagttcgggcacatggaggtcgac
ggcaaggaggccgagcaccgggcggcgtcctccgtgaaggagaagaaggatctgtcgtac
aaggagtgggcggccgaggtcagccgcgtcctcacccggttcgagaacctcctgtggccg
gatctgttcatcgccggcggcggaatcagccgcaaacacgagaagtggatcccccatctg
accaacaggacacccgtcgtacctgctgcgctgctcaacacggcgggaatcgtcggcgct
gcgctcgcggtcgaaacgggcatcgctccgtaa

DBGET integrated database retrieval system