KEGG   Rhodococcus opacus B4: ROP_72080Help
Entry
ROP_72080         CDS       T00882                                 

Gene name
echA
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00071  Fatty acid degradation
rop00280  Valine, leucine and isoleucine degradation
rop00281  Geraniol degradation
rop00310  Lysine degradation
rop00360  Phenylalanine metabolism
rop00362  Benzoate degradation
rop00380  Tryptophan metabolism
rop00410  beta-Alanine metabolism
rop00627  Aminobenzoate degradation
rop00640  Propanoate metabolism
rop00650  Butanoate metabolism
rop00903  Limonene and pinene degradation
rop00930  Caprolactam degradation
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01212  Fatty acid metabolism
Module
rop_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ROP_72080 (echA)
   00650 Butanoate metabolism
    ROP_72080 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_72080 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROP_72080 (echA)
   00310 Lysine degradation
    ROP_72080 (echA)
   00360 Phenylalanine metabolism
    ROP_72080 (echA)
   00380 Tryptophan metabolism
    ROP_72080 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ROP_72080 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ROP_72080 (echA)
   00281 Geraniol degradation
    ROP_72080 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_72080 (echA)
   00627 Aminobenzoate degradation
    ROP_72080 (echA)
   00930 Caprolactam degradation
    ROP_72080 (echA)
Enzymes [BR:rop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ROP_72080 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 HCV_NS4b Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: BAH55455
NITE: ROP_72080
UniProt: C1B644
Position
complement(7871173..7871994)
Genome map
AA seq 273 aa AA seqDB search
MTAIAEKATSFEDQGGDYEHLRVERRGPVALITLDRPKALNALCNALTEELTAALDATEA
DDSIGAVVLTGSAKAFAAGADIKEMQPKSFTDVYLEDFITASWERASTTRKPIIAAVAGY
ALGGGAELAMSCDFIIAAETAKFGQPEITLGILPGAGGTQRLARAVGKSKAMDMVLTGRT
IDAEEAERIGLVARVVPASNVVDEAVKAAAKIAGFSRPAVLMAKESVDRAFETTLSEGLR
FERRMFHASFATEDKAEGMSAFLDKRTPMFTHR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccattgcagagaaggccacctcgttcgaggaccaggggggagattacgaacat
ctccgcgtcgaacgccggggcccggttgcgctgatcacgctcgaccgtccgaaggccctc
aacgccctgtgcaacgccctcaccgaggagctgaccgccgccctcgatgccaccgaagcc
gacgacagcatcggcgccgtcgtcctgaccggcagcgccaaggccttcgccgccggcgcc
gacatcaaggagatgcagcccaagtccttcaccgacgtctacctcgaagacttcatcacg
gccagctgggaacgcgcctccaccacccgcaagcccatcatcgccgcggtcgccggctac
gccctcggcggcggcgccgaactcgcgatgagctgcgacttcatcatcgctgccgagacc
gccaagttcggtcagccagagatcaccctcgggattctgcccggcgccggcggcacccag
cgtctggcccgcgcggtcggcaagtccaaggcgatggacatggtcctgaccggtcgcaca
atcgacgccgaggaggcggagcgcatcgggctggtcgctcgggtcgttccggccagcaac
gtggtcgatgaagcggtcaaggcagcggcgaagatcgccgggttctcccggcccgcggtg
ctgatggccaaggagtcggtcgaccgcgcgttcgagacgaccctgtcggaggggctgcgc
ttcgagcggcggatgttccatgcttccttcgccaccgaagacaaggccgaggggatgtcg
gcgttcctcgacaagcgcaccccgatgttcacccatcgctga

DBGET integrated database retrieval system