KEGG   Rhodococcus opacus B4: ROP_pROB02-01600
Entry
ROP_pROB02-01600  CDS       T00882                                 

Gene name
bnzA3
Definition
(GenBank) benzene dioxygenase ferredoxin subunit
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
rop  Rhodococcus opacus B4
Pathway
rop00621  Dioxin degradation
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
rop01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    ROP_pROB02-01600 (bnzA3)
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: BAD95525
NITE: ROP_pROB02-01600
UniProt: Q588I7
Position
pROB02:172176..172499
AA seq 107 aa
MALTKICSSGDLAPGEMLRFEEGPEPILVCNVGGEFFATQDTCSHADWALSDGYLKDDVV
ECTLHWAKFCVRTGKAKALPACLPLRTFVVKLEGDDVLVDLEGGVTT
NT seq 324 nt   +upstreamnt  +downstreamnt
atggccctcacaaagatatgcagctccggcgatttggcgccgggtgagatgcttcgcttc
gaggaaggtccagagccgattctggtctgtaacgtgggcggagagttcttcgcgactcag
gacacctgcagccatgccgattgggcactctcagacgggtatctcaaggacgacgtcgtg
gagtgcacactccactgggccaagttttgcgtgcgcactggcaaggcgaaggcgctcccg
gcctgtctgccgttgcggacctttgtggtcaaactcgagggagacgacgttctcgtggac
ctcgagggcggagtgacgacatga

DBGET integrated database retrieval system