KEGG   Rhodococcus opacus B4: ROP_pROB02-01630
Entry
ROP_pROB02-01630  CDS       T00882                                 

Gene name
bnzB
Definition
(GenBank) benzene glycol dehydrogenase
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00621  Dioxin degradation
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
rop01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    ROP_pROB02-01630 (bnzB)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     ROP_pROB02-01630 (bnzB)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase 3Beta_HSD TrkA_N Shikimate_DH
Other DBs
NCBI-ProteinID: BAD95528
NITE: ROP_pROB02-01630
UniProt: Q588I4
Position
pROB02:175051..175863
AA seq 270 aa
MGWLEDNVMIVTGGGSGLGRALVERFLGEGARVGVLEKSAEKAEKLANDFGEDVLVVEGD
VRKYDDNARVVQETVRQFGRLDTFVANAAIWDFSTKMVDIPVDRLDALFDEMFHINVKGY
LHGARAAVEELAATGGSIIYTVSNAGFYPGGGGPLYTASKHAVVGLIKELAFELGPKIRV
NGVAPGAMPTDLRGPGSLGMGETTITSVPLGDLVKQCTVLQELPEAADYTGHYVLLASKA
NSRTATGAIINCDGGMGVRGLAETAGGNDL
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggttggctggaagacaacgtcatgatcgtcaccggcggagggtcgggcctaggccgg
gcgctggtcgagcgattcctgggagaaggagcccgggtgggtgtcctggagaagtcggcg
gagaaggctgagaagcttgccaacgacttcggcgaggatgtcctcgtggtcgaaggcgac
gtgcgcaagtacgacgacaatgcgcgcgtcgtccaggaaacggttcgccagttcggtcgc
ctcgacacgttcgtcgcgaacgccgcgatctgggacttctcgacgaagatggtcgatatc
ccggtggaccgactggacgccctcttcgacgaaatgttccacatcaacgtcaagggctac
ttgcacggtgcacgtgcggcggtcgaggagctcgccgccaccggaggctcgatcatctac
accgtgtcgaacgccggcttctaccccggcggcggcggcccgctctacaccgcgtcgaag
cacgcggtagtcgggctgatcaaggaactggccttcgaactcggccccaagatccgcgtc
aacggggtggctccgggcgcaatgcccaccgatctgagaggacctggttcgctcggaatg
ggcgaaaccaccatcacctcagtgccgctcggcgatctggtcaaacagtgcaccgtgctg
caggagctgcccgaggcggcggactacaccgggcactacgttctgctggcttcgaaggcg
aactcgaggacggcaaccggcgcgattatcaactgtgacggcgggatgggggtgcgcggc
ttggccgagacggccggcggaaacgacctgtaa

DBGET integrated database retrieval system