KEGG   Rhodococcus opacus B4: ROP_pROB02-02250Help
Entry
ROP_pROB02-02250  CDS       T00882                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00360  Phenylalanine metabolism
rop00362  Benzoate degradation
rop00620  Pyruvate metabolism
rop00621  Dioxin degradation
rop00622  Xylene degradation
rop00650  Butanoate metabolism
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
rop01220  Degradation of aromatic compounds
Module
rop_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
rop_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROP_pROB02-02250
   00650 Butanoate metabolism
    ROP_pROB02-02250
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ROP_pROB02-02250
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_pROB02-02250
   00622 Xylene degradation
    ROP_pROB02-02250
   00621 Dioxin degradation
    ROP_pROB02-02250
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ROP_pROB02-02250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N Peptidase_A25
Motif
Other DBs
NCBI-ProteinID: BAH47232
NITE: ROP_pROB02-02250
UniProt: C1BE29
Position
pROB02:complement(226153..227136)
Genome map
AA seq 327 aa AA seqDB search
MSENTRKVTVAVIGSGNIGTDLMIKVIRHSDVLQMGAMVGIDPDSDGLARARRLGVPTTA
VGVHGLLELPNFDEIDVVFDATSAKAHAANAALLEPLGKRLIDLTPAALGPFVVPAVNLD
EHRHAANVNMVTCGGQATIPIVAAVSRVTPVAYAEIVASIASKSAGPGTRANIDEFTETT
SHAIETVGGARRGKAIIVLNPADPPLIMRDTVLCLISARDPATHDAIRNSIQAMVEHVAT
YVPGYRLKQQVQITPVPDGQPVHTLLASGDTAAPTHQVSVFLEVEGAAHYLPAYAGNLDI
MTSAAVRYAESVADTIAAPAATQGATR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacacccgtaaggtcaccgtcgcggtgatcggatccggcaacatcggcacc
gacctgatgatcaaggtgatccgccactccgacgtcctgcagatgggcgcgatggtgggc
atcgaccccgactccgacggcctcgcccgcgcccgccgcctcggcgtccccaccaccgcc
gtcggcgtccacggcctgctggagctgccgaacttcgacgagatcgacgtggtcttcgac
gccacctccgccaaggcacacgccgccaacgccgccctgctcgaaccgctcggcaaacgg
ctgatcgacctcaccccggccgccctcggcccgttcgtggtgccggcggtcaacctcgac
gaacaccgtcacgccgccaacgtcaacatggtcacctgcggcggtcaggccaccatcccg
atcgtcgccgccgtctcccgcgtgacaccggtcgcctacgccgagatcgttgcctccatc
gcctcgaagtccgcgggaccgggcacccgggcgaacatcgacgagttcaccgaaaccacc
tcccacgccatcgaaaccgtcggcggcgcccgccgcggcaaggccatcatcgtcctcaac
ccggccgacccgccgctgatcatgcgggacacggtcctgtgcctgatctccgcccgcgac
ccggccacccacgacgccatccggaactcgatccaggcgatggtcgagcacgtcgcgacc
tacgtgcccggctaccggctcaagcagcaggtccagatcaccccggtcccggacggccaa
cccgtgcacaccctgctcgcgtccggggacacggcggcacccacccaccaggtgtcggtg
ttcctcgaagtcgaaggcgccgcacactacctgccggcctacgccggcaacctcgacatc
atgacctcggccgcggtccgctacgccgagtccgtcgccgacacgatcgccgccccggcg
gcaacccagggagccacccgatga

DBGET integrated database retrieval system