KEGG   Raoultella ornithinolytica B6: RORB6_01015Help
Entry
RORB6_01015       CDS       T02625                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ror00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RORB6_01015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ror02000]
    RORB6_01015
Transporters [BR:ror02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    RORB6_01015
   Histidine transporter
    RORB6_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1656
Motif
Other DBs
NCBI-ProteinID: AGJ84901
Position
226802..227488
Genome map
AA seq 228 aa AA seqDB search
MLYGFSQVILQGALVTLELALSSVVLAVLIGLAGAGAKLSSNRPLALVFEGYTTLIRGVP
DLVLMLLIFYGLQIALNTLTDALGLSQFDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFSNGQTFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWQPFYFAIVCGLVYLVFTTVSNGVLLLLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacgggttttcacaggttattttacagggcgctcttgtcacactggagctggct
cttagttcggttgtgctggcggtcctcattggtctggcgggtgccggagctaagctatcg
agcaatcgaccgctggcgctggtatttgaaggctacaccacgctaattcgtggcgtgccc
gatctggtgctgatgctgctgattttctacggtctgcagattgcgctgaatacgctcacc
gacgcactgggactatcacagtttgatattgacccaatggtcgcggggattattacgctg
ggctttatctacggtgcctattttactgaaaccttccgcggcgctttcatggcggttccg
aaaggacacatcgaagcggcgacggcctttggcttcagtaacgggcagaccttccggcgg
atcctctttccggcaatgatgcgctatgcgttaccgggaattggcaacaactggcaggtt
atcctcaaggcaacggcgctggtctctctgctggggctggaagatgtggtcaaagccacc
cagctggcggggaaaagtacctggcagccgttctactttgcgatcgtctgcggtctggtt
tatctcgtgtttaccacagtttccaatggtgtactgctgctgcttgaacgccgttactcc
gtgggcgtgaagagggctgacctgtga

DBGET integrated database retrieval system