KEGG   Raoultella ornithinolytica B6: RORB6_12515Help
Entry
RORB6_12515       CDS       T02625                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00052  Galactose metabolism
ror00500  Starch and sucrose metabolism
ror01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    RORB6_12515
   00500 Starch and sucrose metabolism
    RORB6_12515
Enzymes [BR:ror01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     RORB6_12515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGJ87186
Position
2743187..2744587
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPRALADSHYPRWHHAPVTGLMNDPNGFVEFAGRYHLFYQWNP
LACDHTFKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVDNNGTLTLCYTGNVK
FADGSRTAWQCLATENPDGTFSKTGPVLPLPEGYTGHVRDPKVWQHEGRWYMVLGAQDRQ
KRGKVLLFSSANLHEWTSEGEIAGAGINGLHDAGYMWECPDLFPLGDQHILICCPQGIPG
EEARYLNTYPAVWMAGGFDYASAAFTHGELHELDAGFEFYAPQTMQTADGRRLLVGWMGV
PDGEEMRQPTRANGWIHQMTCLRELEWVDGKLYQRPLRELSALRGEVRSWQGNVLPLAPL
EIALDTAADDAFSLDFGGALTLERDSHGLRLARRSLASDEMLYRYWRGTVRSLRIFIDQS
SVEIFINDGEGVMSSRLFPDYPAQLVFSGATPVTFCYWSLEPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttccatcacgcctgcctgcgattttgcaggccgttatgcaaggccagccgcgc
gcgctggccgacagccactatccccgctggcaccacgcgccggtcaccgggctgatgaac
gatcccaacggctttgtcgaatttgccgggcgctatcacctgttctatcagtggaacccg
ctcgcctgcgatcacaccttcaaatgctgggggcactggagttctgccgatctgctgcac
tggcggcatgaaccgattgcgctgatgccggacgaagagtatgaccgcaacggctgctac
tcaggcagcgcggtggataacaacgggacgctgaccctgtgctacaccggcaacgtcaaa
tttgcagacggcagccggaccgcctggcagtgcctggcgacggaaaatcccgacggcacc
ttcagcaaaaccggcccggtcctgccgctgccagagggctataccggccacgtgcgcgac
ccgaaagtctggcagcatgaaggccgctggtacatggtgctgggtgcgcaggatcggcaa
aagcgcggcaaggtgctgctgttcagctccgcaaatctccatgagtggacgagcgagggc
gaaatcgccggcgccggcatcaacggactgcacgatgccggttatatgtgggagtgtccg
gacctgttcccgcttggcgaccagcatattctgatttgctgcccgcaggggattcccggc
gaggaagcgcgctacctcaacacctatccggcggtgtggatggccggcggcttcgattac
gccagcgccgccttcacgcacggcgagttgcacgagctggatgccggatttgagttctat
gccccgcaaaccatgcagacagccgacggccgtcggctgctggttggctggatgggcgta
ccggacggcgaggagatgcgccagccgacgcgggccaacggctggatccaccagatgacc
tgcctgcgcgaactggagtgggtggacggcaaactctatcagcgcccgctgcgcgaactg
agcgccctgcgcggcgaagtccgcagctggcagggcaacgttctgccgctggccccgctg
gaaatcgccctcgataccgccgctgacgacgcgtttagcctcgatttcggcggcgcgttg
actctcgagcgcgatagccacggccttcgtctggcgcggcgcagcctcgccagcgacgaa
atgctctatcgctattggcgcggcacggttcgctcgctgcggatcttcatcgaccagtcg
agcgtggagattttcattaacgacggcgaaggggtgatgagcagccgcctcttcccggac
tatcccgcacagctggttttcagcggcgcgacgccggtaacattctgctactggtcgctg
gagccatgcatggtagaataa

DBGET integrated database retrieval system