KEGG   Raoultella ornithinolytica B6: RORB6_17490Help
Entry
RORB6_17490       CDS       T02625                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00270  Cysteine and methionine metabolism
ror00920  Sulfur metabolism
ror01100  Metabolic pathways
ror01110  Biosynthesis of secondary metabolites
ror01130  Biosynthesis of antibiotics
ror01230  Biosynthesis of amino acids
Module
ror_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    RORB6_17490
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RORB6_17490
Enzymes [BR:ror01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     RORB6_17490
    2.3.1.46  homoserine O-succinyltransferase
     RORB6_17490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AGJ88179
Position
complement(3843887..3844816)
Genome map
AA seq 309 aa AA seqDB search
MPIRVQDELPAVNFLRSENVFVMTTTRATTQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQLDIQLLRIDARESRNTPSEHLNNFYCNFDDICDQNFDGLIVTGAPLGLVEFNDVAY
WPQIKQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTRAEKISGVYEHHILHPHALLT
RGFDDSFLAPHSRYADFPAALIRDYTDLEILAETEEGDAYLFASKDKRIAFVTGHPEYDA
NTLASEYFRDVEAGLSPDIPYNYFPQNDPQNKPRATWRSHGNLLFANWLNYYVYQITPYD
LRNMNPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcgggtgcaggacgagctaccagccgtcaatttcttgcgtagtgagaacgtc
tttgtgatgacgactacgcgtgcaacaactcaggaaattcgtccgctgaaggtacttatc
cttaacctgatgccgaaaaaaatcgagacggagaatcagttcctgcgcctgctttcgaac
tctccgctgcagcttgatatccagcttttgcgcatcgatgcgcgtgaatcccgcaatacg
ccaagtgaacacctgaataacttctactgtaacttcgacgatatttgcgaccagaacttt
gacggcctgatcgtcaccggcgccccgctggggctggttgaatttaatgatgttgcctac
tggccgcagatcaaacaggtgctggagtgggcgaaagatcacgtcacctctacgcttttt
gtctgttgggcggtacaggctgcactcaatattctgtatggcattcctaagcagacccgc
gcagaaaaaatttccggcgtttatgagcatcatattctgcatcctcacgcgctgctgacc
cgcggttttgatgactctttcctcgccccacactctcgctacgcggatttcccggcggcg
ctgattcgcgactacaccgatttagagatcctggcagaaacggaagagggtgatgcctac
ctgtttgccagcaaagataagcgaattgcctttgtgaccggccacccggaatacgatgcc
aacactctggccagcgaatatttccgcgatgtggaagccggcctgagtccggacatcccg
tataattatttcccgcaaaacgatccgcaaaacaaaccgcgagccacctggcgcagccat
ggaaatctgctgtttgcaaactggcttaactattacgtctaccagatcactccatacgat
ctgcggaatatgaatccgactttggattaa

DBGET integrated database retrieval system