KEGG   Raoultella ornithinolytica B6: RORB6_18305Help
Entry
RORB6_18305       CDS       T02625                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00052  Galactose metabolism
ror00561  Glycerolipid metabolism
ror00600  Sphingolipid metabolism
ror01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RORB6_18305
  Lipid metabolism
   00561 Glycerolipid metabolism
    RORB6_18305
   00600 Sphingolipid metabolism
    RORB6_18305
Enzymes [BR:ror01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RORB6_18305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2
Motif
Other DBs
NCBI-ProteinID: AGJ88341
Position
complement(4043379..4045502)
Genome map
AA seq 707 aa AA seqDB search
MSDSILRLQSATVDVVIKTQPFAEIIYWGPHLAHFSPQDADTLARPIANGRLDVDSPVTL
MAELGHGLFGAPGIEGHRQGLDGSPVFVTTGALQEGQRLTLTSEDKQAGLRLESDIELDS
SGVLRVRHGVTNLRPQPWQVDRLAVTLPVAERAREVMAFHGRWIREFQPHRLTLEHDSFV
LENRRGRTSHEHFPALITGSPAFCEMEGEVWGVHLGWSGNHRLRAEVKTDGRRYLQAEAL
YLPGEMALAEGETLWTPSLYASYSAQGLNGMSQQFHRYLREQIIRFPGNKPRPVHLNTWE
GIYFDHDPQYIMRMADEAAALGVERFIIDDGWFKGRNDDWAALGDWYLDEQKYPNGLTPV
IDHVKSLGMEFGIWVEPEMINPNSDLYRAHPDWVLALPGYKSPTGRHQYVLNLNIPQAFD
YLLERMSWLLGEHAVDYVKWDMNRELVQPAHNGKAAADAQTRQFYRLLDTLVARFPQIEF
ESCSSGGGRIDYEVLKRSHRFWASDNNDALERNTIQRGMSYFFPPEVMGAHIGNRHCHAT
FRQHSIAFRGLTALFGHMGLELDPVSADEQERAGYRKYAALHKQWRDVIHHGVQWRLDMP
DTTTLAHGVVSEDKGQALFLVSQLAMPDYSLMAPLRIAGLEAGARYHITLLDHPNIQVTG
EGGHTMRKLPAWMTSPQTVSGEWLQQAGLALPILDPESAILIGLQRV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcgattttacgtctgcaaagcgccacggttgatgtggtgatcaaaacccag
ccgttcgccgaaataatctactgggggccgcatttagctcacttttcgccgcaggatgct
gacacgcttgctcgcccgatcgccaacgggcgccttgatgttgactcgccggtcaccttg
atggccgaactgggccacgggttgttcggcgcgccggggattgaggggcatcgtcagggc
ctggatggttcgccggtctttgtcactaccggggctttgcaggaggggcagcgcttaacg
ctgaccagcgaagacaagcaggccggtctgcgtctggaaagcgacattgagctcgatagc
agcggcgttctgcgcgtccgacacggcgtaaccaatcttcgcccgcagccctggcaggtc
gatcgcctggccgtaacgctaccggttgccgagcgtgcccgcgaagttatggcgttccac
ggccgctggattcgcgaatttcagccgcatcgtctgactctcgaacacgatagttttgtg
ctggaaaatcgccgtggacgcacctcccatgaacatttcccggcgctgattaccggtagc
ccggcgttttgcgaaatggagggagaggtctggggcgtgcatctgggctggagcggcaac
caccgtctgcgcgcggaggtgaaaaccgacggccgccgctacctacaggcggaagccttg
tatctgccgggcgaaatggcgctcgcggaaggggaaacgttgtggacacccagcctctat
gccagctattccgctcaggggctgaacggcatgagtcagcagttccaccgctatctgcgt
gagcagatcattcgctttccgggcaataaaccgcgaccggtgcatctcaatacctgggaa
gggatttacttcgaccatgacccgcaatacatcatgcgcatggcggatgaggcggcagcg
ctgggcgtcgagcgatttatcatagacgacggctggtttaaagggcgcaacgacgactgg
gcggcgctcggcgactggtatctcgatgagcagaaataccccaatggcctgacgccggtg
attgaccatgtgaagtcgctgggcatggagtttggtatctgggttgaaccggaaatgatt
aacccgaactccgatttataccgcgcgcatcctgactgggtgctggcgctgccgggctat
aagtcaccgaccggacgtcatcagtatgttctgaacctgaatatccctcaggcgttcgac
tatctgctggagcggatgagctggctgctgggcgagcatgcggttgattatgtgaagtgg
gatatgaaccgcgagctggtgcagccggcgcataacggcaaagcggcggccgacgcgcaa
acccgtcagttttatcgcctgctggataccttagtggcccgcttcccgcagatcgagttt
gaatcctgttcttccggcggcggacgcattgattacgaggtgcttaaacgcagccaccgc
ttctgggcttcagacaataacgatgcgctggagcgtaataccatccagcgcggcatgagt
tatttcttcccgccggaagtgatgggggcgcatatcggcaaccgtcactgtcacgctact
ttccgtcagcacagtatcgcttttcgcggcctgaccgcgctgtttggtcatatggggctg
gagctggatccggtgagcgccgatgaacaggagcgtgccggctaccgcaagtatgcggcg
ctacataagcagtggcgcgacgtgattcatcatggcgtgcagtggcggctggatatgccg
gataccaccacccttgcacacggcgtggtcagtgaagataaggggcaggcgctgtttctg
gtgagccagctggcaatgcccgattacagcctgatggcgccgctgcgcattgcgggtctg
gaggcgggggcgcggtatcacattacgctccttgatcaccccaatattcaggtaacgggg
gagggcggccacaccatgcgcaagctgccggcgtggatgacctcaccgcagacggtaagc
ggcgagtggttgcaacaggcgggactggcgctgccgattctcgacccggaaagcgccatt
ttgattggtctgcaacgcgtgtga

DBGET integrated database retrieval system