KEGG   Raoultella ornithinolytica B6: RORB6_21685Help
Entry
RORB6_21685       CDS       T02625                                 

Definition
(GenBank) alpha-dehydro-beta-deoxy-D-glucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00053  Ascorbate and aldarate metabolism
ror01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    RORB6_21685
Enzymes [BR:ror01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     RORB6_21685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI PK Catalase_C
Motif
Other DBs
NCBI-ProteinID: AGJ89017
Position
4765927..4766697
Genome map
AA seq 256 aa AA seqDB search
MNNDIFPNKFKAALAAHQIQIGCWSALASPITTEVLGLAGFDWLVLDGEHAPNDISTFIP
QLMALKGSVSAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVESEKEALDAVAATRYPPEGI
RGVSVSHRANMFGTVPDYFAQSNQNITLLVQIESQQGVDNVDAIAATAGVDGIFVGPSDL
AAALGHLGNASHPQVQQAIQHIFASAKKHGKPSGILAPVEADARRYLEWGATFVAVGSDL
GVFRSATQKLADSFKK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgatatcttcccgaacaaatttaaggcggccctggcggcgcatcagattcaa
attggttgctggtccgccctggccagccccatcacgacagaagtattaggcctggccggt
ttcgactggctggtgctggacggcgaacatgcgccgaacgatatctccacctttatcccc
cagttgatggcgctgaaaggcagcgtcagcgcgccggttgtgcgcgtaccgactaacgag
ccggtgatcattaagcgcctgctggatattggtttctataactttttgatcccgtttgtg
gaaagcgaaaaggaagcgctcgacgctgtcgccgccacgcgctatccgccagaaggaatt
cgcggcgtttccgtgtcgcaccgcgccaacatgtttggcacggtgccggattacttcgcg
cagtcgaaccaaaacatcaccctcctggtacaaattgaaagccagcagggggtggataat
gtcgatgcgattgccgcgactgcgggcgttgacggtatttttgtcggcccaagcgacctg
gccgccgcgctgggacatctgggcaacgcctctcacccgcaggtccagcaggctatccag
cacatctttgcgagcgcgaaaaagcacggcaagccgagcggtattctggcgccggtagaa
gcggatgcgcgtcgttatctggaatggggcgcgacctttgtcgccgtcggcagcgatctg
ggcgtattccgctccgccacgcagaaactggctgattcctttaagaaataa

DBGET integrated database retrieval system