KEGG   Raoultella ornithinolytica B6: RORB6_22110Help
Entry
RORB6_22110       CDS       T02625                                 

Definition
(GenBank) sensor protein QseC
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror02020  Two-component system
ror02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ror00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RORB6_22110
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RORB6_22110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ror01001]
    RORB6_22110
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ror02022]
    RORB6_22110
Enzymes [BR:ror01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     RORB6_22110
Protein kinases [BR:ror01001]
 Histidine kinases
  OmpR family
   RORB6_22110
Two-component system [BR:ror02022]
 OmpR family
  QseC-QseB (quorum sensing)
   RORB6_22110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HAMP HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AGJ89102
Position
complement(4851864..4853204)
Genome map
AA seq 446 aa AA seqDB search
MKRLSLRVRLTLLFFLLTSAAWGIACFFAWQQTTEKLDKLFDTQQLLFARRLSAMNFDEL
HTLTAPVRTKKKIKHGHLDDDALAFVIFTADGKRLLHDGENGQDIPWQNRREGFSDGYLN
NDDDEWRFLQLTTGDGRYRIVVGQEWDYRREMALDIVTSQLTPWLVALPLMFLLLIVLLS
RELAPLKQLARTLRLRAPDSAESLNVDKVPSEVRPLVDALNQLFARTHDTMIRERRFTSD
AAHELRSPLAALKVQTEVAQLSMDDPQGREKALAQLHEGIDRATRLVDQLLTLSRLDSLA
QLDDVHTIAIDELLQSSVMEMYHSAQQAGIELRLHLNATQVMQPGQPLLLSLLVRNLLDN
AVRYSPRGSQVDITLDAREFSVRDNGPGVSPEALVRIGERFYRPPGQDEPGSGLGLSIVR
RIAALHRMTVDFSNAPEGGFAARVRW
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacttagcctgcgcgtccgcctgacgctcctgtttttcctgctgaccagcgcg
gcctggggcatcgcctgcttttttgcctggcaacaaaccacggaaaaactggataagctc
tttgatacccaacagctgctgtttgcccgccgactgagcgccatgaatttcgacgagctg
catacgctcacggcgccggtgcggacaaaaaagaagatcaagcacggccacctcgatgac
gacgcgctggcgttcgtgattttcacggccgacggcaagcgcctgcttcacgacggcgag
aatggtcaggacatcccgtggcagaatcgtcgggaaggcttcagcgatggctatctgaat
aacgatgatgatgaatggcgcttcctgcagctaaccaccggcgatggccgctaccgtatt
gtcgtgggtcaggagtgggactaccggcgggaaatggcgctggatatcgtcacctcccag
ctgactccctggctggtggcgctgccgctgatgttcctgctgctgattgtgctattgagc
cgggagctggcgccgttaaaacagctggccagaacgctgcgtctgcgcgcgccggactcg
gcggaatcgcttaacgtcgacaaggtgcccagtgaagtccggccgctggtcgatgccctg
aatcagctgtttgctcgtacgcatgacaccatgatacgcgagcgccggtttacctccgat
gccgcacacgagctgcgcagcccgcttgcagccctgaaagtgcagactgaagtcgctcag
ctatcaatggacgacccgcaggggcgggagaaagcgctggcgcagctgcatgaaggaatt
gaccgcgcaacccggctggtagaccagcttttaacgttgtcgcgcctcgattctctggcg
cagcttgatgatgtgcatacgatagccatcgatgagctgctgcaatcgtcggtcatggag
atgtaccactctgcgcagcaggcgggcattgagcttcgcctgcacctgaacgcaactcag
gtcatgcagccgggccagccgctgctgctgagtctgctggtgcgcaatctgctggataac
gccgtacgctacagcccgcgcggcagccaggtcgatatcactcttgatgcccgtgagttt
tccgttcgcgataatggcccgggcgtcagccccgaggcgctggtgcgtatcggcgagcgc
ttctatcgccctcccggccaggatgagcccggtagcggtctgggattatctatcgtccgc
cgcattgccgcgctgcaccggatgacggtagacttcagcaacgcgcccgaaggcggtttc
gcggcgcgcgtgcgctggtag

DBGET integrated database retrieval system