KEGG   Raoultella ornithinolytica B6: RORB6_23235Help
Entry
RORB6_23235       CDS       T02625                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00071  Fatty acid degradation
ror00072  Synthesis and degradation of ketone bodies
ror00280  Valine, leucine and isoleucine degradation
ror00310  Lysine degradation
ror00362  Benzoate degradation
ror00380  Tryptophan metabolism
ror00620  Pyruvate metabolism
ror00630  Glyoxylate and dicarboxylate metabolism
ror00640  Propanoate metabolism
ror00650  Butanoate metabolism
ror00900  Terpenoid backbone biosynthesis
ror01100  Metabolic pathways
ror01110  Biosynthesis of secondary metabolites
ror01120  Microbial metabolism in diverse environments
ror01130  Biosynthesis of antibiotics
ror01200  Carbon metabolism
ror01212  Fatty acid metabolism
ror02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ror00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RORB6_23235
   00630 Glyoxylate and dicarboxylate metabolism
    RORB6_23235
   00640 Propanoate metabolism
    RORB6_23235
   00650 Butanoate metabolism
    RORB6_23235
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RORB6_23235
   00072 Synthesis and degradation of ketone bodies
    RORB6_23235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RORB6_23235
   00310 Lysine degradation
    RORB6_23235
   00380 Tryptophan metabolism
    RORB6_23235
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RORB6_23235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RORB6_23235
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RORB6_23235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ror04147]
    RORB6_23235
Enzymes [BR:ror01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RORB6_23235
Exosome [BR:ror04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RORB6_23235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGJ89327
Position
5078040..5079218
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGTLSRHSAVELGSLVVKALVERTGIDPQSVDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAWAL
SSQQKARRAIDSGRFRDEIVPVTTELNGAPRTVDTDEQPRVDASAEGLASLLPTFDRLGS
VTAGNASSINDGAAAVMMMSESKAQELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWRLDEVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtgatcgtgggtgcgttgcgcactccgatagggtgttttcagggaacg
ttgtcgcgtcactccgcggtagagttggggagtcttgtggtcaaggctctggtggagcgt
accggtatcgacccgcaaagtgttgatgaggtgatcctcgggcaggttctgactgcgggg
accgggcaaaatccggcccgtcaatcggcgatccgcggcggcctgccgaataccgtttct
gccattacgattaacgacgtgtgtggctccggactgaaggcgctgcatctggcgacgcag
gcaatccagtgcggagaagctgacgtggtgattgccggcggtcaggaaaatatgagccgg
gcgccgcacgttctcaccgatagccgcaccggcgctcagctgggcaacagccagctgatt
gacagcctggtccacgatggtttgtgggatgccttcaacgactatcacatgggagttacg
gcggaaaacctggcgcgtgaatatggtatcagccgggagctgcaggatgcctgggcgctg
agttcgcagcaaaaggcccggcgggcgattgattcagggcgctttcgtgatgagattgtg
ccggtaaccaccgagctgaacggggcgccgcgcaccgttgacaccgatgagcagccgcgg
gtcgatgccagcgccgaagggctggccagcctgctacccaccttcgatcggctgggttca
gtgaccgcgggcaacgcttccagcatcaatgacggcgcggcggcggtaatgatgatgagc
gaatcgaaagcgcaggagctcggtctgccgatcctggcgcggatccgcgcttttgccagc
gtcggcgtcgatccggccctgatggggatcgcgccggtacacgcgacgcgccgctgtctg
gaaagagcgggctggcggctggatgaggtcgatcttatcgaggccaatgaggcatttgcc
gcccaggcgatttctgtcggcagagtgctggaatgggatgagcggcgggtcaatgttaac
ggcggggcgattgcgctgggccaccccattggggcatcaggctgtcgaattctggtttct
ctggtgcacgagatgattaaacgcgatgcccgtaaagggttggcaacgctttgtatcggc
ggcggtcagggcgttgcgctggcggtagaacgcgcatag

DBGET integrated database retrieval system