KEGG   Raoultella ornithinolytica B6: RORB6_23270Help
Entry
RORB6_23270       CDS       T02625                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00052  Galactose metabolism
ror00500  Starch and sucrose metabolism
ror01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RORB6_23270
   00500 Starch and sucrose metabolism
    RORB6_23270
Enzymes [BR:ror01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     RORB6_23270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGJ89334
Position
5087223..5088656
Genome map
AA seq 477 aa AA seqDB search
MMYTVANAEQELQAKRETLNLRWYPRYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PSDEENLYQVQCLATSRDGIHFERQGMVLDTPPGLHHFRDPKVWREGDSWYMIVGARVGD
TGQVRLYRSADLRQWHDEGILDEAEDKMGYMWECPDFFTLGGKRVLMFSPQGMAAQGYQN
RNLFQSGYLLGDWQPGQPFVREGEFVEMDHGHDFYAPQSFLTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELTLSADNRLQMRPAKEVECLRRAWFPWPVSTLKNQRSLMAENGE
AMEVILHWDCAGSTAEQYGLSFGEGLRVYVDAQMQRLVLERNYPQYGLCGTRSVPLHEGA
DLKLRVFFDSSSVEVFVNDGEACLSSRIYPDAARRELSLFAWNGLASLTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacaccgttgctaacgctgaacaggaactgcaggcgaaacgcgagacgttaaac
ctgcgctggtacccacgctaccatctcgccgctcgtgcgggctggatcaacgatcccaat
ggtctggtctggtttgacggctggtatcacgccttttatcagcaccatccttactccacg
cagtgggggccgatgcactggggtcatgcgcgcagcaaggatttagtccattgggaacac
ctgccggtggcgctggcgccggaagggccggaggataaagatggctgtttctccggctcg
gccgtggtggacggcgatacgctggcactgatctataccgggcataaattccacggcgat
cccagcgacgaagagaacctctatcaggtgcagtgtctggccaccagccgcgacggcatt
cattttgaacgccagggcatggtgctggataccccgccgggcctgcaccacttccgcgac
ccgaaagtgtggcgcgaaggggatagctggtacatgatcgtcggtgcccgcgtcggtgat
accggccaggtgcggctgtatcgttccgccgatctgcgccagtggcatgacgaagggatc
cttgatgaagccgaagataagatgggctacatgtgggaatgccccgacttcttcacgctc
ggcggcaagcgagtactgatgttttcaccgcaggggatggcggcacagggctatcagaac
cgcaatttattccagagcggctatctgctcggcgactggcagcccgggcagccgtttgtc
cgggaaggtgaatttgttgagatggaccatggccatgatttttatgccccgcagagtttc
ctgacgcccgacggtcgccgcatcgttatcggctggctggacatgtgggagtcaccgctg
ccggaacagcaggacggctgggctggcatgctctctctgccgcgtgagctgacgctgagc
gccgataatcgtctgcagatgcgtccggcgaaagaggtggagtgcctgcgcagagcctgg
ttcccgtggccggtcagcacgctgaaaaaccaacggtcgctgatggcggaaaacggtgag
gcgatggaggtgatcctgcactgggactgcgcaggcagtacggcagaacagtatggactg
agcttcggcgaggggctgcgggtctacgttgatgcgcagatgcaacgcctggtgctggag
cggaactacccgcagtacggtctgtgcggcacgcgcagcgtaccgttgcacgagggggcc
gatctgaaactgcgggtattcttcgatagctcttccgttgaagtgtttgttaatgacgga
gaggcctgtcttagtagccgtatatatccggatgccgctcgccgtgaattatctttattt
gcctggaacggtttggcgtctttaactgaagcaggagcctggcagctggaataa

DBGET integrated database retrieval system