KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_00765Help
Entry
CTJ15_00765       CDS       T05160                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ros  Roseomonas sp. FDAARGOS_362
Pathway
ros00450  Selenocompound metabolism
ros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ros00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CTJ15_00765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ros03016]
    CTJ15_00765
Enzymes [BR:ros01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CTJ15_00765
Transfer RNA biogenesis [BR:ros03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CTJ15_00765
 Prokaryotic Type
    CTJ15_00765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ATR19120
UniProt: A0A2D2GZB5
Position
unnamed1:172255..173301
Genome map
AA seq 348 aa AA seqDB search
MSDPTIRLTELAHGGGCGCKLAPAVLRELLSEQPMAGPFRQLLVGTETSDDAAVWQVNED
LAVIATTDFFMPMVDNPEDFGRIAATNALSDIYAMGGQPIMALAILGMPINKLEPAVIRR
ILAGGASVCAEAGIPVAGGHSIDAPEPIYGLAVIGLCHPAQVRRNAGAQPGDALILTKGL
GVGIYSAAIKKGALPDGAYAEMLASTTLLNRVGAELAKDPAVHGITDVTGFGILGHALEM
AQGSGLCLTLRLDDLPWLSHAAALAERGFITGASDRNWASYGDRIALPAGLPDWRRRLLA
DPQTSGGLLVACVETEAARILSGIREAGYPAARIVGRAEPGEARVAVA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcccacgatccgcctgaccgaactcgcccatggcggcggctgcggctgcaag
ctcgccccggcggtgctgcgggagctcctgtccgaacagcccatggccggtcccttccgg
cagttgctggtcgggaccgagacctcggacgatgccgccgtctggcaggtgaacgaggat
ctggcggtgatcgccaccaccgacttcttcatgccgatggtggacaacccggaagatttc
gggcggatcgccgccaccaacgccctgtcggatatctatgcgatgggcggccagccgatc
atggccctggccatcctgggcatgccgatcaacaagctggaaccggcggtgatccggcgg
atcctggcgggtggcgcctcggtctgcgccgaggccggaattcccgtggccggtggccat
tccattgacgcgccggagccgatctacgggctggcggtgatcggcctctgccatcccgcc
caggtgcgccgcaatgccggagcccagccgggcgatgcgctgatcctgaccaaggggttg
ggcgttggcatctattccgccgccatcaagaagggcgccctgccggacggggcctatgcc
gagatgctggcctccaccaccctgctgaaccgggtcggcgcggaactggccaaggacccc
gccgtgcatggcatcaccgatgtcaccggcttcggcatcctggggcacgcgctggagatg
gcgcagggttccggcctttgcctgaccctgcggctcgatgacctgccctggctgtcccac
gccgccgcgctggccgagcgcggcttcatcaccggcgcctccgaccgcaactgggccagc
tatggcgacaggatcgcgctgccggccggcctgccggactggcggcgtcggctgctggcc
gatccgcaaacctcgggcgggctgctcgtcgcctgcgtggagacggaagcggcccgcatc
ctgtccggcatccgggaggcgggctatcctgccgctcgcatcgtcggccgtgccgagccg
ggcgaggcgcgggtggcggtcgcctga

DBGET integrated database retrieval system