KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_08625Help
Entry
CTJ15_08625       CDS       T05160                                 

Gene name
ribB
Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
ros  Roseomonas sp. FDAARGOS_362
Pathway
ros00740  Riboflavin metabolism
ros00790  Folate biosynthesis
ros01100  Metabolic pathways
ros01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ros00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CTJ15_08625 (ribB)
   00790 Folate biosynthesis
    CTJ15_08625 (ribB)
Enzymes [BR:ros01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CTJ15_08625 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CTJ15_08625 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ATR20362
UniProt: A0A2D2H2W5
Position
831520..832677
Genome map
AA seq 385 aa AA seqDB search
MSASATNQPVSASLADFLSPTEELIEEARRGRMFILVDDEDRENEGDLVIPAQFATPDAI
NFMARHARGLICLAMTRARVESLGLPLMSQSNGTRHQTAFTVSIEAREGVSTGISAADRA
RTVAVAINPEMGRRDIVTPGHVFPLAAREGGVLVRAGHTEASVDFARLAGLNPAGVICEI
MNDDGTMARLPDLVAFAQHHGLKLGTVADLIAYRRRTERLVKRVEENVLEDAPGGPWKII
VYANTIEYGEHIALVKGEPDRNGPALVRMHAVNMLADTLSRQGPAELHAAMEEIGRSGHG
VVVLLREMKPTALSERVRAGQGRAAPELRDYGIGAQILTDLGVKEMVLLSNHPRPIVGLE
GYGLTVVDTRPISECGKAGQKGKQA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctctgcgaccaaccagcccgtctccgcctcgctcgcggatttcctcagcccg
accgaggagctgatcgaggaggcccgccgcggccgcatgttcatcctcgtggacgacgag
gaccgcgagaacgagggcgacctcgtgatcccggcgcagttcgccacgccggacgcgatc
aacttcatggcccggcacgcgcgtgggctgatctgcctcgccatgacccgcgcccgggtc
gagtcactgggcctgccgctgatgagccagagcaacggcacccggcaccagaccgccttc
accgtctcgatcgaggcgcgggaaggggtgagcaccggcatctccgccgccgaccgggcc
cgcaccgtggcggtcgcgatcaacccggagatgggccgccgcgacatcgtgacccccggc
catgtcttcccgctggcggcgcgcgagggcggcgtgctggtgcgcgccggccataccgag
gcctcggtggatttcgcgcggctggccgggctgaaccccgccggcgtgatctgcgagatc
atgaacgacgacggcaccatggctcgcctgccggacctcgtggccttcgcccagcaccac
gggctgaagctcggcacggtggccgacctgatcgcctatcgccgccgcaccgagcggctg
gtgaagcgggtcgaggagaacgtgctggaggatgcgccgggcgggccctggaagatcatc
gtctatgccaacaccatcgagtatggcgagcacatcgccctggtgaagggcgagcccgac
cgcaacggccccgctctggtgcggatgcacgcggtgaacatgctggccgacacgctgagc
cgccagggaccggccgagctgcatgccgcgatggaggagatcggccgctccggccacggc
gtggtcgtgctgctgcgcgagatgaagccgacggcgctgagcgagcgggtccgcgccggc
cagggccgcgcggcgccggagctgcgggactacggcatcggcgcgcagatcctgacggat
ctgggcgtgaaggagatggtgctgctgtcgaaccacccccgccccatcgtcgggctggag
ggctatgggctgacggtggtggacacgcggccgatctcggaatgcgggaaggccggccag
aaggggaagcaggcatga

DBGET integrated database retrieval system