KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_11320Help
Entry
CTJ15_11320       CDS       T05160                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ros  Roseomonas sp. FDAARGOS_362
Brite
KEGG Orthology (KO) [BR:ros00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CTJ15_11320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ATR20833
UniProt: A0A2D2H490
Position
complement(1389102..1390730)
Genome map
AA seq 542 aa AA seqDB search
MSDTILRGAGGALTSPRPDLDRKPHAFGAIAFILVFAGGLGYAAFSIAQDMRSVGEHGLA
TGALVMLGLALVIALGFEFVNGFHDTANAVATVIYTHSLAPLTAVVWSGFWNFLGVLTSS
GAVAFTVVTLLPVELILQVGSTAGYAMIFALLLAAAIWNLGTWAMGLPNSSSHALIGSII
GVGLANQLLAPAGSATSGVDWNQAVNVFESLLFSPLIGFVLAAVLLLAMRFVVRNEALYR
APEGNKPPPVAIRALLIATCTGVSFFHGSNDGQKGMGLIMLILIGAAPTAYALNRATPDS
ATPAFVETAQRASGIFASHAGGAPRPESAAAARSVVGDALKVREVNRPEVYAALAVLTQD
IGRQVQGYGAVRLVPAAATPNVRNDMYLASDAVRVMGAHPAGFGDEEVAALKSMRGLLDE
GTRFIPTWVKVTVALALGLGTMVGWKRIVVTVGERIGKTHLTYAQGASAEIVAMGTIGLA
DAYGLPVSTTHVLSSGVAGTMVANGSGLQWATVRNLAMAWVLTLPAAMAIAGGLYVLLRQ
VF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccatcctccggggcgccgggggggcactcacctccccgcgtccggatctc
gaccgcaagccgcatgccttcggggccattgccttcatcctcgtgttcgccggcgggctc
ggctatgcggccttcagcatcgcgcaggacatgcggagcgtgggcgagcacggcctggcg
accggcgccctcgtcatgctcggcctggccctggtgatcgcgctgggcttcgagttcgtg
aacggcttccacgacaccgcgaatgccgtggcgaccgtgatctacacgcacagcctggcg
cccctgacggcggtggtctggtcgggcttctggaacttcctgggcgtgctgacctccagc
ggcgcggtcgccttcaccgtcgtcaccctgctgccggtcgagctgatcctgcaggtcggc
agcaccgcgggctatgcgatgatcttcgccctgctgctcgccgcggcgatctggaacctc
ggcacctgggcgatgggcctgcccaacagctcctcgcatgcgctgatcggctcgatcatc
ggcgtgggcctcgccaaccagctcctggcgccggccggctccgccacctccggcgtggac
tggaaccaggcggtcaatgtcttcgagtccctgctgttcagcccgctcatcggcttcgtg
ctggcggcagtgctgctgctggcgatgcgcttcgtggtgcgcaacgaggcgctctaccgc
gcgccggagggcaacaagccgccgccggtggcgatccgcgcgctgctgatcgccacctgc
accggcgtctccttcttccacggcagcaatgacgggcagaagggtatgggcctgatcatg
ctgatcctgatcggcgccgcaccgacggcctatgcgctgaaccgcgccacgccggacagc
gccacgccggcctttgtcgagacggcgcagcgggccagcggcatcttcgccagccatgcc
ggcggcgccccgaggccggaaagcgccgccgccgcgcgctccgtcgtcggcgacgcgctg
aaggtgcgcgaggtcaaccggcccgaggtctatgccgccctggcggtgctgacccaggat
atcgggcggcaggtgcagggctacggcgcggtgcggctggtgcccgcggcggcgacgccg
aacgttcgcaacgacatgtacctcgcctccgacgcggtacgggtgatgggcgcgcatccg
gcgggcttcggtgatgaggaggtcgcggcgctgaagtcgatgcgcggtctgctcgacgaa
ggcaccaggttcatcccgacctgggtgaaggtcacggtcgcgctggcgctgggcctcggc
accatggtgggctggaagcgcatcgtggtgacggtgggcgagcggatcggcaagacgcac
ctgacctacgcgcagggggcctcggccgagatcgtggccatgggcacgatcggactggcc
gatgcctacggcctgccggtctccaccacccatgtcctgtccagcggcgtcgccggcacc
atggtggccaatggttcggggctgcaatgggcgacggtgcggaacctggcgatggcctgg
gtgctgaccctgccggccgccatggccatcgccggcgggctctacgtgctgctgcgccag
gtcttctga

DBGET integrated database retrieval system