KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_23060Help
Entry
CTJ15_23060       CDS       T05160                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ros  Roseomonas sp. FDAARGOS_362
Pathway
ros00471  D-Glutamine and D-glutamate metabolism
ros00550  Peptidoglycan biosynthesis
ros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ros00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CTJ15_23060
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTJ15_23060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ros01011]
    CTJ15_23060
Enzymes [BR:ros01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     CTJ15_23060
Peptidoglycan biosynthesis and degradation proteins [BR:ros01011]
 Precursor biosynthesis
  Amino acid ligase
   CTJ15_23060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M IlvN NAD_binding_2 Mur_ligase_C 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_2 TrkA_N ApbA NAD_binding_8 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ATR23273
UniProt: A0A2D2HB67
Position
complement(4065803..4067164)
Genome map
AA seq 453 aa AA seqDB search
MPEGYDFKPFANRHIAVVGLGKAGLPAAYRLRDWGAEIVVWDDSQAQREAAEAAGFTVAD
VTAAPFAQDTLLLSPGIPHRLPRTHPAAARALAAGAPILCDAEFLFLAARAAGSKAQFVG
ITGTNGKSTTTALLRHILKGAGMPVAAGANLGPAATALPLLARGAYVLEMSSYMLERLDA
LHFDLGAMLNLSPDHLDRHGGMPGYTDAKARILAGNRVSVLGMDDAASRALAPRIRNRLM
PISGTTPQPGGVWAEGRLLRDDAGPILDLGEAAALPGTHNAQNAAAAAALALALGITRAQ
LAEGLRSYPGLPHRQERVAERGGVLYVNDSKATNADSTAWALGTYPRVVWIAGGVPKEGG
IEPLASLFPHVAHAVLIGRCAGEFAATLAAHGVPHETAGTLEAALPAARAAAQRLGAPVV
LLSPAAASFDQYSGFEARGEHFRTLVQSLEKAA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
ctgccggagggctatgacttcaagcccttcgccaaccgccacatcgcggtggtcgggctg
ggcaaggccggcctgcccgccgcctaccggctgcgggactggggcgcggaaatcgtggtc
tgggacgacagccaagcgcagcgcgaggccgccgaggccgccggcttcaccgtggcggac
gtgaccgccgcgcccttcgcccaggacacgctgctgctctcccccggcatcccgcaccgg
ctgccgcgcacccacccggccgcggcccgggcactggcggcgggggcgccgatcctctgc
gacgcggagttcctcttcctcgccgcccgcgccgccggctccaaggcgcagttcgtcggc
atcaccggcaccaacggcaagtccaccaccaccgccctgctgcgccacatcctgaagggc
gccgggatgccggtggccgccggcgccaatctcggccccgccgccaccgccctgcccctg
ctggcccgcggcgcctatgtgctggaaatgtcgtcctacatgctggagcggctggacgcg
ctccacttcgacctgggggcgatgctcaacctgagccccgaccacctggaccgccatggc
ggcatgccgggctacaccgacgccaaggcccgcatcctcgccggcaaccgggtctcggtc
ctggggatggacgacgcggcctcccgcgccctggccccgcgcatccgcaaccggctgatg
cccatctccggcaccacgccgcagcccggcggcgtctgggccgaggggcgcctgctgcgc
gacgatgctggcccgatcctcgatctcggcgaggccgccgccctgccgggcacgcacaac
gcccagaacgccgccgccgccgccgccctggcgctcgccctcggcatcacccgggcgcag
ctggcggaggggctgcggagctatcccggcctgccgcaccggcaggagcgcgtggcggag
cggggcggcgtcctctacgtcaacgacagcaaggccaccaatgccgacagcaccgcctgg
gcgctcggcacctaccctcgcgtggtctggatcgccggcggcgtgcccaaggaaggcggg
atcgaacccctggcctccctcttcccgcatgttgcccatgccgtgctgatcggccgctgc
gccggggaattcgccgccaccctcgccgcccatggcgtgccgcacgagaccgccggcacg
ctggaggccgccctgcccgccgcccgcgccgccgcgcaacgcctgggcgcgccggtggtc
ctgctgagccccgccgccgcctccttcgaccagtacagcggcttcgaggcgcgtggcgag
cacttccgcaccctggtgcaatccctggaaaaggcggcctga

DBGET integrated database retrieval system