KEGG   Rahnella sp. ERMR1 05: BV494_08340Help
Entry
BV494_08340       CDS       T05331                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rox00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BV494_08340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rox01007]
    BV494_08340
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rox03016]
    BV494_08340
   03029 Mitochondrial biogenesis [BR:rox03029]
    BV494_08340
Enzymes [BR:rox01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BV494_08340
Amino acid related enzymes [BR:rox01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BV494_08340
Transfer RNA biogenesis [BR:rox03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BV494_08340
 Prokaryotic Type
   Other AARSs
    BV494_08340
Mitochondrial biogenesis [BR:rox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BV494_08340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AVF34943
UniProt: A0A2L1UPS9
Position
1852994..1854727
Genome map
AA seq 577 aa AA seqDB search
MNIQALLSDKVSQALIAAGASADSEAQVRQSAKAQFGDYQANGVMSVAKKLGMPPRQLAE
KVVELLDLSGIANKVEIAGPGFINIFLDPVFVGAHVDSALNHEKLGIAPVEPQTIVIDYS
APNVAKEMHVGHIRSTIIGDAAVRTNELLGHKVIRANHVGDWGTQFGMLIAYLEKIQNEN
AGDMNLADLEEFYRAAKKNYDEDEAFAERARGYVVKLQGGDEYCLQMWRKLVDVTMKQNQ
LTYNRLNVTLTEDDVMGESLYNSMLPGIVSDLQSKGLAVDSEGAVVVYLDEYKNKEGDPM
GVIIRKKDGGYLYTTTDIACAKYRYETLGADRVLYYIDSRQHQHLMQAWTIARKAGYVPD
SVALEHHMFGMMLGKDGKPFKTRSGGTVKLSDLLDEAIERARKLITEKNPELKDAEELEK
LVNAVGIGAIKYADLSKSRTTDYIFDWDNMLAFEGNTAPYMQYAYTRVASIFKRAEIDVN
SLTQPVVLSEEREAALATRLLQFEEVLTVVAREGTPHTMCAYLYDVAGLFSSFYEHCPIL
NAEDETSRNSRLKLALLTQRTLKTGLDTLGIETVERM
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattcaggcacttctttcagataaagtcagccaggcgctgatcgcagctggcgca
tccgccgacagcgaagcgcaggtccgtcagtccgctaaggctcagtttggcgactatcag
gctaatggcgtcatgtccgtggcgaaaaaactcggtatgccaccacgacaactggcagag
aaagtggttgaactgttggatctgagcggcatcgcgaataaagtcgaaattgccggtcct
ggctttatcaacattttcctggatccggtgttcgtcggcgcacacgtcgacagtgcgctg
aatcacgaaaaactgggtatcgcgcccgtagagccgcaaaccatcgttatcgactattct
gcgccaaacgtggcgaaagaaatgcacgttggtcacatccgctccaccatcatcggcgat
gccgctgtccgtaccaatgaactgctcggccacaaagtcatccgcgccaaccacgtgggc
gactggggcacgcagttcgggatgctgattgcctatctcgaaaaaattcaaaacgagaac
gccggtgacatgaatctggccgacctcgaagaattctaccgcgccgcgaaaaagaactac
gacgaagacgaagcctttgccgaacgtgcgcgtggttacgtggtgaaactacagggcggc
gacgagtactgtttgcagatgtggcgcaaactggtcgatgtgaccatgaagcaaaaccag
ctgacgtataaccgtctgaacgtcaccctgaccgaagacgacgttatgggagaaagcctg
tataacagcatgctgccgggcatcgtgtctgacttgcagtcaaaaggtctggccgtcgac
agcgaaggtgccgtcgtggtttatctggacgagtacaagaataaagaaggcgacccgatg
ggcgtcattatccgtaagaaagatggcggctatttgtacaccaccaccgacatcgcctgt
gcgaaataccgctacgaaacgctgggtgccgatcgtgtgctgtattacatcgactcccgt
cagcaccagcatttaatgcaggcctggaccatcgcgcgtaaagccggttatgtccctgat
tccgttgcgcttgaacaccacatgtttggcatgatgctgggtaaagatggtaagccgttc
aaaacccgctcaggtggcacggtgaaactgtctgatttgctggacgaagcgattgaacgc
gcacgcaagctcatcacagaaaagaatcctgagctgaaagatgcggaagaactggaaaaa
ctggtcaacgccgtcggtattggcgcaatcaaatatgctgatctgtcgaaaagccgcacc
accgattacatcttcgactgggacaacatgctggcctttgaaggtaacaccgcgccgtac
atgcaatatgcgtacacccgcgtggcgtcaatcttcaaacgtgcagagatcgacgtaaat
agcctgacccaaccggttgtactgagcgaagaacgtgaagccgcgctggccacccgtctg
ctgcaatttgaagaagtgctgaccgttgtcgcccgtgaaggcacgccacacaccatgtgc
gcctatctctacgacgtggcaggcctgttctccagcttctacgaacattgtccgatcctg
aacgcagaagatgaaaccagccgcaacagccgcctgaaactggcactgctaacccagcgc
acgctgaaaaccggtctggatacgctgggtatcgaaaccgtagaacgtatgtaa

DBGET integrated database retrieval system