KEGG   Rahnella sp. ERMR1 05: BV494_09435Help
Entry
BV494_09435       CDS       T05331                                 

Definition
(GenBank) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
rox  Rahnella sp. ERMR1:05
Brite
KEGG Orthology (KO) [BR:rox00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rox03009]
    BV494_09435
Enzymes [BR:rox01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BV494_09435
Ribosome biogenesis [BR:rox03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BV494_09435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Ubie_methyltran Methyltransf_32 Methyltransf_23 Methyltransf_12 Methyltransf_29 MTS RrnaAD Methyltransf_4 Methyltransf_18 Methyltransf_33 PrmA MetW CMAS PCMT NodS FtsJ
Motif
Other DBs
NCBI-ProteinID: AVF35139
UniProt: A0A2L1UQC1
Position
complement(2077812..2078636)
Genome map
AA seq 274 aa AA seqDB search
MTYQCPLCFQPLELTGQQWRCAANHQFDNAKEGYVNLMPVQHKRSKQPGDSTEMMVSRRA
FLDAGHYQPLRERLADILDTVLPETAETLLDIGCGEGYYTTALAERLTQRRKISIFGLDV
AKVAIRYAAKRYHNASFCVASSHRLPFADNSLDAVVRIYAPCKAQELYRAVKPDGVVLTV
APGPRHLYQLKGMIYQDVQLHADLDEQLEGFERVSTETLAYGMRLSGAEAFDLLQMTPFA
WRATEEVMANLKSQSAFECETDFVIRLHQRKSDQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaatgtccactttgtttccagccgcttgagctgaccggccagcaatggcga
tgtgccgctaatcatcagtttgataacgcaaaagaaggctatgtcaatctgatgccagtg
cagcataaacgctcgaaacaaccgggggacagcaccgaaatgatggtgtcgcgccgcgcg
tttctcgatgccggacattaccagccgctgcgtgaacggttggcggatatcttagatact
gtgttgccggaaaccgcagaaacgttgctggatattggctgcggggaagggtactacacc
accgcgctggcggagcgtttaacgcaacgtcgcaaaataagtatcttcgggctggacgtg
gcaaaggtggctatccgttatgcggctaaacgctatcacaacgcctctttttgcgttgcc
tccagccatcgtttgccgttcgccgacaactcgctggacgccgtggtacgcatctatgcg
ccgtgcaaagcgcaggagctttatcgtgcggttaaacccgacggcgtggtactcaccgtc
gcacctggcccgcgtcatttatatcagctgaaaggtatgatttatcaggatgttcagctg
cacgctgatctggatgaacagcttgaaggcttcgagcgtgtgagcacagaaacgctggct
tatggtatgcgcctgtcaggcgctgaggcgtttgatttgctgcaaatgacgccgtttgca
tggcgggcgacggaagaagtcatggcgaacttgaagtctcagtctgcgttcgaatgtgag
actgactttgtgatcaggctgcaccagcgcaaatctgaccaatag

DBGET integrated database retrieval system