KEGG   Rahnella sp. ERMR1 05: BV494_17210Help
Entry
BV494_17210       CDS       T05331                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00770  Pantothenate and CoA biosynthesis
rox01100  Metabolic pathways
Module
rox_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BV494_17210
Enzymes [BR:rox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BV494_17210
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BV494_17210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DUF4567
Motif
Other DBs
NCBI-ProteinID: AVF36561
UniProt: A0A2L1UUG3
Position
complement(3734992..3736206)
Genome map
AA seq 404 aa AA seqDB search
MTGLSGKHIVLGISGGIAAYKAPELVRRLRERGAEVRVVMTQAAKSFVTPLSLQAVSGYP
VSDDLLDPAAEAAMGHIELGKWADLVLIAPATADLLARMNAGMANDLLTTVCLATAAPVA
VLPAMNQQMYRAAVTQENLEKLAARGTLIWGPDSGSQACGDIGPGRMLDPLVIVDLANTH
FSARKDLAHLNIMVTAGPTREALDPVRFISNHSSGKMGFAIAKAAADRGAHVTLIAGPVS
QPTPPNVRRIDVESALDMQKAVQLSAASQQIFIACAAVADYRAQLVAEEKIKKQGDEITV
KMVKNPDIVAGVAAMTENRPYVVGFAAETQNVEEYARQKRIRKNLDLICANDVSLAGQGF
NTDTNALHLFWQDGDKILPLSDKSLLGQRLLEEIVSRYDEKNRH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacgggactttccggcaaacatattgtgctcggtatcagcggtggtatcgctgcctat
aaagcaccagaactggtacgtcgcttacgtgaaagaggcgcagaggtgcgcgtggtcatg
acacaagcggcgaaatcctttgtgactcccctgagcctgcaggccgtttctggctatccg
gtctctgatgacttgcttgatccggctgccgaagcggcaatggggcatatcgagctgggc
aagtgggctgatttagttctgattgctcccgccacggcagatttactggcgcgaatgaac
gccggtatggcgaatgacctgctgacaaccgtctgtctggcaaccgccgcgccggtcgcc
gtgttgccggcgatgaatcagcagatgtaccgcgcagccgtgactcaggaaaacctggaa
aaactggccgcacgcggcacgctaatctggggccccgacagcggaagccaggcctgtggc
gatataggcccaggccggatgctggatccgctggtgatcgtcgatttggctaatacgcat
ttctctgcccgtaaagatctggcgcatctgaatattatggttaccgcaggcccgacgcgc
gaagcgctcgacccggtgcgttttatcagtaaccacagttcaggaaagatggggtttgct
attgccaaagcggccgctgaccgcggtgctcatgtcacactgattgccgggcctgtgtcg
caaccgacgccgccaaacgtccgccgcattgacgtcgaaagcgcgctggatatgcaaaaa
gccgttcagctttccgccgcttcacagcagattttcatcgcctgtgccgccgtcgcggat
taccgtgcacaattggttgctgaagaaaaaatcaaaaaacaaggtgatgaaatcactgta
aaaatggtcaaaaaccccgatattgtggcaggcgtagcggcaatgacggagaaccggccg
tatgttgtggggtttgccgcagaaacccagaatgtggaagaatacgcgcggcaaaaaagg
atccgcaagaatctggatctgatttgcgccaacgacgtttcacttgccgggcagggtttc
aatactgataccaatgccttgcatcttttttggcaggacggggataaaatcttaccgctc
agcgataagtccctgcttggtcaacgtttattagaagagattgtcagccgttatgatgaa
aaaaatcgacattaa

DBGET integrated database retrieval system