KEGG   Rahnella sp. ERMR1 05: BV494_18695Help
Entry
BV494_18695       CDS       T05331                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rox  Rahnella sp. ERMR1:05
Pathway
rox00010  Glycolysis / Gluconeogenesis
rox00053  Ascorbate and aldarate metabolism
rox00071  Fatty acid degradation
rox00280  Valine, leucine and isoleucine degradation
rox00310  Lysine degradation
rox00330  Arginine and proline metabolism
rox00340  Histidine metabolism
rox00380  Tryptophan metabolism
rox00410  beta-Alanine metabolism
rox00561  Glycerolipid metabolism
rox00620  Pyruvate metabolism
rox00625  Chloroalkane and chloroalkene degradation
rox00903  Limonene and pinene degradation
rox01100  Metabolic pathways
rox01110  Biosynthesis of secondary metabolites
rox01120  Microbial metabolism in diverse environments
rox01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BV494_18695
   00053 Ascorbate and aldarate metabolism
    BV494_18695
   00620 Pyruvate metabolism
    BV494_18695
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BV494_18695
   00561 Glycerolipid metabolism
    BV494_18695
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BV494_18695
   00310 Lysine degradation
    BV494_18695
   00330 Arginine and proline metabolism
    BV494_18695
   00340 Histidine metabolism
    BV494_18695
   00380 Tryptophan metabolism
    BV494_18695
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BV494_18695
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BV494_18695
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BV494_18695
Enzymes [BR:rox01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BV494_18695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AVF36818
UniProt: A0A2L1UVG2
Position
4056550..4057971
Genome map
AA seq 473 aa AA seqDB search
MKQINQIYINGEFVTPHGTEVMHLIDPVTEQVAAQVRLADETDTRQAIAAAKAAYVDFSR
TSKAQRIQYLQQLHDAVLARADLLETVMSAEYGGPLAMVRGTVARASGAFLQAIKLLNEY
EFVRQIGKAKVVMEPLGVVGLITPWNANYGFICNKMATALAAGSTVVIKPSELSAGQTQL
LTECLHAAGLPAGVFNIVTGRGDVVGAEITRHPDIAKISFTGSTSVGKAIARGAVDTLKR
VTLELGGKSPNILLPDVDLEKAIPLALAVGTMNNGQACIAGTRLLVPEERLEEVKAHLVR
AVASVKVGDPQQTDTQIGPLVTAKQYARVQNYIRLGVEEGAELVCGGEGRPDGLSHGYFV
KPTVFANVTPQMTIAREEIFGPVISVLTYRSIEEAVSMANDTVYGLQAYVSGEDRQQARS
VASQIIAGRVFVNGMYDAPDAPFGGFKQSGLGREFGTYGLEAYLEPKTLIDDE
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagattaatcaaatctatattaacggcgagttcgtcaccccgcacggcactgaa
gtgatgcacctgatcgatccggtgacggaacaggtcgcggcgcaggttcgtctggccgat
gaaaccgatacccgccaggcgattgctgccgcaaaagcggcttacgttgatttctcacgg
accagcaaagcgcagcgcattcagtatttacagcaactgcacgatgcggtgctggcgcgg
gcggacttgctggaaacggtgatgagcgccgaatatggcggcccgctggcgatggtacgc
ggcaccgtggcgcgggcgtccggcgcatttttgcaggcgataaaactgctcaatgagtat
gaatttgtccgccagattggcaaggcgaaagtggtgatggaaccgctgggcgtcgtcgga
ctgattacgccgtggaacgctaactacggtttcatctgcaataaaatggcgaccgcgctg
gcggcgggcagcacggtggtgattaagcccagcgaactgagcgcgggccagacgcagttg
ctgacagagtgcctgcacgccgcgggtttaccggcgggcgtgtttaatattgttaccgga
cgcggcgacgtggtcggcgcagaaattacccgtcaccctgatatcgcgaaaatatccttt
accggttcgacgtcggtgggcaaagcgattgcccgtggcgcggtagacaccctgaaacgc
gtgacgctggaactcggcggtaagtcgcctaacattcttctgccggatgttgatctcgaa
aaagccattccgctggcgctggcggttggcacgatgaataacggccaggcatgcatcgca
ggtacccgtttgctggtcccggaagaacggctggaagaagtgaaagcgcatctggtgcgc
gcggtcgcgagcgtcaaagtgggcgacccgcagcagacggatacgcaaatcggcccgctg
gtgacggcaaaacagtacgcccgcgtacagaattatattcgtctcggcgttgaagaaggt
gcggagctggtgtgcggcggcgaagggcggccagacgggctgagccacggttattttgtg
aaaccgacggtgtttgcgaacgtcacgccgcagatgaccatcgcccgcgaagaaatattc
gggccggtgatttcggtgctgacctatcgcagcattgaggaagcggtcagcatggcgaac
gacacggtttatggtttgcaagcttatgtcagcggcgaagatcgccagcaggcgcgcagc
gttgcgtcacaaattatcgccgggcgggtgtttgtcaacggcatgtacgacgcgccggac
gcgccgtttggtggcttcaaacagtccggtctgggccgtgaatttggtacttacgggctg
gaagcgtatcttgagccgaagaccctgatcgacgatgagtga

DBGET integrated database retrieval system